About Products Protein Database Contact

yjhX1

Gene
yjhX1
Protein
UPF0386 protein YjhX 1
Organism
Salmonella typhi
Length
85 amino acids
Similarity
Belongs to the UPF0386 family.
Mass
9.55 kDa
Sequence
MNLSRQEQRTLHVLAKGGRIVHVRDASGRVTSVECYSREGLLLADCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRSQPDNR