About Products Protein Database Contact

yjgA

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain K12 / MC4100 / BW2952)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain K12 / DH10B)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O9:H4 (strain HS)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O1:K1 / APEC
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.373 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIEQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain K12)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain SE11)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain SMS-3-5 / SECEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain UTI89 / UPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella agona (strain SL483)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.41 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGRNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVDPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEILNLWPNADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella choleraesuis (strain SC-B67)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella dublin (strain CT_02021853)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella enteritidis PT4 (strain P125109)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.42 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVVEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella heidelberg (strain SL476)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O139:H28 (strain E24377A / ETEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O45:K1 (strain S88 / ExPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli (strain 55989 / EAEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O157:H7
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.402 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTRIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O81 (strain ED1a)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Escherichia coli O8 (strain IAI1)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella newport (strain SL254)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.422 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDTDLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella paratyphi C (strain RKS4594)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella paratyphi A (strain AKU_12601)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.422 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDTDLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella schwarzengrund (strain CVM19633)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella typhi
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.392 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.431 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEE

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Shigella boydii serotype 4 (strain Sb227)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.431 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEE

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Shigella flexneri serotype 5b (strain 8401)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.385 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRPAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Shigella flexneri
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.433 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALYKIPLDADLRPAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Shigella sonnei (strain Ss046)
Length
183 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.359 kDa
Sequence
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
UPF0307 protein YjgA
Organism
Shigella dysenteriae serotype 1 (strain Sd197)
Length
181 amino acids
Similarity
Belongs to the UPF0307 family.
Mass
21.101 kDa
Sequence
MTKQPEDWLDDVPGDDIEDDEIIWVSKSEIKRDTEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIAQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG

Gene
yjgA
Protein
Uncharacterized membrane protein YjgA
Organism
Bacillus subtilis (strain 168)
Length
132 amino acids
Mass
14.774 kDa
Sequence
MKRNRWIYAVFTILIIGLGLGSRAFSSVLPDTLNTYLGDSLWAAMIFTGCGFLFRKLKTMITGIISLSFCFVIEFSQLYHAEWIDQIRDTSLGGLVLGYGFLWSDIEAYTIGIAACAAIELLVLGIKKRRCM