About Products Protein Database Contact

yidL

Gene
yidL
Protein
Uncharacterized HTH-type transcriptional regulator YidL
Organism
Escherichia coli (strain K12)
Length
297 amino acids
Mass
33.958 kDa
Sequence
MNGKLQSSDVKNETPYNIPLLINENVISSGISLISLWHTYADEHYRVIWPRDKKKPLIANSWVAVYTVQGCGKILLKNGEQITLHGNCIIFLKPMDIHSYHCEGLVWEQYWMEFTPTSMMDIPVGQQSVIYNGEIYNQELTEVAELITSPEAIKNNLAVAFLTKIIYQWICLMYADGKKDPQRRQIEKLIATLHASLQQRWSVADMAATIPCSEAWLRRLFLRYTGKTPKEYYLDARLDLALSLLKQQGNSVGEVADTLNFFDSFHFSKAFKHKFGYAPSAVLKNTDQHPTDASPHN