yidC1

Membrane protein insertase YidC 1

308 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.105 kDa

MKSIKRFALSAMGVAMLLVLTGCVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQSWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFPILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDEMQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVREELAKNPPKASAFSKPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR

yidC1

Membrane protein insertase YidC 1

308 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.021 kDa

MKSIKRFALSAMGAAMLLVLTGCVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQSWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFPILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDEMQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVHEELAKNPSKASAFSTPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR

yidC1

Membrane protein insertase YidC 1

307 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.248 kDa

MKSKKGLTLTITLGTLALFLSGCVQTTKAGKPYGFVYEYLAKPGQNVMEWLSQLFGNNYGWAIIGLTVIVRLVLLPMMINQQRKSTYQQEKMSAVRPQMEKIQARQKAATTQEEKAAISNELMQLYRDNGISMTGGIGCLPLLIQLPIFSALYYAIRYSPELSKATFMGISLGKSSLILAILAFLSYLAQGYLSMIGLPEEQKKTMRLMLIMSPVMILFVSMSAPAGLGLYFFVGGLFACLQTLIINFFRPRIRREVEAELKKHPIKTPTPTQPKPINATESKPSHPRPQNNAGRGRNAGKQQRHHK

yidC1

Membrane protein insertase YidC 1

290 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

33.747 kDa

MKKKALLPLFLGIMIFLAGCDYSTPEKQDGFFFNTFVQPMKHLLQWLGNDVFHNNFGLAIIVLVLFIRLILLPFMLSNYKNSHMMREKMKVAKPEVDGIQEKVKRARTQEEKMAANQELMEVYKKYDMNPMKSMLGCLPILIQMPIIMGLYFVLKDKLVNGLSEHPHFLWFNLTKPDIWITVIAGVLYFIQAVVSSKTMPQEQRQMGYMMMVISPIMIIWISLQASSALGLYWSVSALFLVIQTHFANIYYSKLAKKEVQPFIEKYEREHNPYSKKKGKNTQVVSKKNKK

yidC1

Membrane protein insertase YidC 1

287 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

32.5 kDa

MKKKKRFKQKLLIASLVIGLMAVLSGCGYSTDPITSESTGFWSHYIVFPLSWTITWFSDLFGGSYAVGIIVVTILIRLLIMPLMIKQLKSQKAMTNLQPKIKELQEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMPILLGFYQAISRTAEIKTDSFLWMQLGNPDPYYILPVVAALTTFLSSKISMMGQTQQNKSMAMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQVAEDRLKKKAANMKASKKGGKKRK

yidC1

Membrane protein insertase YidC 1

278 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

32.335 kDa

MHKRLFITLLGFIILLAGCDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVKNMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPVLIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYPKDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAKKLKQKLEQNKDNSELLTEES

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

30.908 kDa

MKKKNIILISVLLGALLLITGCSMDPSQNTDGFFSTYLIQPFTSFIMFVAKFVGGNYGIAIIITTLLIRALIMPLNLRTAKAQMGMQSKMAVAKPEIDEIQARLKRATSKEEQANIQKEMMAVYSKYNINPIQMGCLPLLIQMPILMAFYYAIRGSSEIASHTFLWFNLGSPDMVLAIIAGLVYLAQYFVSMIGYSPEQKKQMKIIGLMSPIMILFVSFTAPSALALYWAVGGLFLAGQTLLTKKLYMNKHPEIKVMEQEEKEFEQIVEEQNKEK

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

30.927 kDa

MKKKNIILISVLLGALLLLTGCSMDPSQNTDGFFSTYLIQPFTSFIMFVAKFVGGNYGIAIIITTLLIRALIMPLNLRTAKAQMGMQSKMAVAKPEIDEIQARLKRATSKEEQATIQKEMMAVYSKYNINPMQMGCLPLLIQMPILMAFYYAIRGSSEIASHTFLWFNLGSPDMVLAIIAGLVYLAQYFVSMIGYSPEQKKQMKIIGLMSPIMILFVSFTAPSALALYWAVGGLFLAGQTLLTKKLYMNKHPEIKVMEQEEKEFEQIVEEQKKEK

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.763 kDa

MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.763 kDa

MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.765 kDa

MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLATKEKNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.735 kDa

MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK

yidC1

Membrane protein insertase YidC 1

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.763 kDa

MRKVLRVKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYLFARAIQWLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQRKYAGKDTQTRMKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWVELAQHDHLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTVSNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK

yidC1

Membrane protein insertase YidC 1

271 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.011 kDa

MKKKLKTFSLILLTGSLLVACGRGEVSSHSATLWEQIVYAFAKSIQWLSFNHSIGLGIILFTLIIRAIMMPLYNMQMKSSQKMQEIQPRLKELQKKYPGKDPDSRLKLNDEMQSMYKAEGVNPYASVLPLLIQLPVLWALFQALTRVSFLKVGTFLSLELSQPDPYYILPVLAALFTFLSTWLTNKAAVEKNIALTLMTYVMPFIILVTSFNFASGVVLYWTVSNAFQVFQILLLNNPYKIIKVREEAVRVAHEKEQRVKRAKRKASKKRK

yidC1

Membrane protein insertase YidC 1

271 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.038 kDa

MKKKLKTFSLILLTGSLLVACGRGEVSSHSATLWEQIVYAFAKSIQWLSFNHSIGLGIILFTLIIRAIMMPLYNMQMKSSQKMQEIQPRLKELQKKYPGKDPDNRLKLNDEMQSMYKAEGVNPYASVLPLLIQLPVLWALFQALTRVSFLKVGTFLSLELSQPDPYYILPVLAALFTFLSTWLTNKAAVEKNIALTLMTYVMPFIILVTSFNFASGVVLYWTVSNAFQVFQILLLNNPYKIIKVREEAVRVAHEKEQRVKRAKRKASKKRK

yidC1

Membrane protein insertase YidC 1

271 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins (By similarity). Partially complements an E.coli yidC depletion experiment.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.326 kDa

MKKKYRIIGLAVAALLFLSACGRSQVTSHSSDAWEKFVYFFAETIRFLSINGRIGIGIILFTFLIRTILLPLFNLQLKSGQKMQELQPELKALQTKYPGKDRESRMRMAEESQELYKKYGVNPYASLFPLLIQMPVLWALYQALTRVEFLKTGSFLWMDIGNKDPYFILPVLAAIFTFLSSWLTNKAAKERNGMMITMNIILPIFILLIGFNLASGVALYWVVSNAYQVFQILLLNNPFKIIAERQRLEDEARELEAKKRRAKKKAHKKRK

yidC1

Membrane protein insertase YidC 1

269 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

30.294 kDa

MKKKFSLIAMAGAALLLLTACGTTAVTSSSTNLWDQIVYGFAQVIRFLSFGGLTGVGIILFTIVIRAALLPLMNIQIKSSQRMQEIQPEIKKIQAKYPSKDMESRRLMNEEIQKLYAENKVNPYMGCLPLVVQMPVLWALYQALSRVDFLKHGTFLWFEIGAKDPTFILPILAAVFTFLSSYLMMKSAPERNAMTTSMTYIMPIFILIMGVNFAAGIALYWVISNAFQVFQTMLLANPYKIIAAREAKVQVEKDKIKAREKALKKARKK

yidC1

Membrane protein insertase YidC 1

260 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

29.569 kDa

MLKSYRAVLVSLSLLLVFVLSGCSNATPIDAHSTGIWDHYFVYPISFMIQFVAHHIPGASFGIAIIIMTLVIRSAMIPLAVSQYRSQAKMKKMQPELQKLKQKYGDVSKDLEKQKQYQKEMSELMKSGGWNPLAGCWPLLIQMPIFSALYYAISRTEEIRTSTFLWVNLGHADPYHILPIIAALTTFIQMKVFQSNSTSGEQVQMLKMQQIMMPAMILFMGFAAPSGLVLYWITGNLFTMMQTIVLRKIMEREELQLQKA

yidC1

Membrane protein insertase YidC 1

260 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

29.565 kDa

MLKSYRAVLVSLSLLFVFVLSGCSNAAPIDAHSTGIWDHYFVYPISFMIQFVAHHIPGASFGIAIIIMTLVIRSAMIPLAVSQYRSQAKMKKMQPELQKLKKKYGDVSKDLEKQKQYQKEMSELMKSGGWNPLAGCWPLLIQMPIFSALYYAISRTEEIRTSSFLWVNLGHADPYHILPIIAALTTFIQMKVFQSNITPGEQVQMLKMQQIMMPAMILFMGFAAPSGLVLYWITGNLFTMTQTIVLRKIMEREELQLQKA

yidC1

Membrane protein insertase YidC 1

257 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

29.223 kDa

MYRKFGMAAMLVSILLLMTGCFNVNEPINAQSEGIWDSYFVYPLSWLMIYFANAFNGSFGLAIIVVTLLIRLLILPLMIKQLKSTRAMQALQPEMQALREKYSAKDQRTQQKLQQETMALFQKHGVNPLAGCFPVLIQMPILLAFYHAIMRTREIGDEHFLWFVLNQPDPILLPIIAGITTFLQQKMMMVTDNPQMKVLLYVMPVMILVFAMFLPSSLALYWVIGNLFMILQTYFITGPNVGAKKVAADVKVGGKKK