WIP1

WPP domain-interacting protein 1

489 amino acids

Mediates and enhances the nuclear envelope docking of RANGAP proteins mediated by WIT1 and WIT2 in the undifferentiated cells of root tips (PubMed:17600715, PubMed:18591351). As component of the SUN-WIP-WIT2-KAKU1 complex, mediates the transfer of cytoplasmic forces to the nuclear envelope (NE), leading to nuclear shape changes (PubMed:25759303).

53.902 kDa

MDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNSVELGKPMSFDSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGVAHSHGKQMQFQSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMDLEIDDDRSSKSSTVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSSLESDSRKQSGRMMDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLALQDALEKEVQQFQEIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLEVKESHIRDLESTTNQSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLIDEQESLAEEQTHETLNKLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRACKITSYVLIQLVLLSTVVLLLLSQLLPEPDTVVPT

WIP1

Bowman-Birk type wound-induced proteinase inhibitor WIP1

102 amino acids

Belongs to the Bowman-Birk serine protease inhibitor family.

10.976 kDa

MKSSPHLVLILCLQAALVMGVFAALAKENAMVESKAIDINPGQLKCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTDTFLGMCGPKC

WIP1

Inner kinetochore subunit WIP1

89 amino acids

Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346).

Belongs to the CENP-W/WIP1 family.

10.244 kDa

MDTEALANYLLRQLSLDAEENKLEDLLQRQNEDQESSQEYNKKLLLACGFQAILRKILLDARTRATAEGLREVYPYHIEAATQAFLDSQ

wip1

Inner kinetochore subunit wip1

73 amino acids

Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly.

Belongs to the CENP-W/WIP1 family.

8.64 kDa

MSYPKARIRRFFRQHCQRSLESSALDLVYLDYCLFLQSLLKEANIEAAKTGERRVQPEHVRSIQRKILAQFKG