whiB7

Transcriptional regulator WhiB7

103 amino acids

Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity). Participates in maintaining a reduced cytoplasmic (MSH/MSSM) environment under normal growth conditions and directly or indirectly controls the concentration of mycothiol (MSH + MSSM).

Belongs to the WhiB family.

10.95 kDa

MSIAMTAPTTGVAPMTCETRLPAVPCHVGDPDLWFAENPGDLERAKALCAGCPIRVQCLTAALERQEPWGVWGGEILDRGSIVARKRPRGRPRKDSGGNPAAA

whiB7

Probable transcriptional regulator WhiB7

92 amino acids

The apo- but not holo-form probably binds DNA (By similarity). Acts as a transcriptional regulator. Probably redox-responsive. Upon overproduction at least 10 other genes are up-regulated, among them are Rv1258c, Rv1988, Rv2301, Rv2416c, Rv2725c and whiB7 itself. Probably redox-responsive. The apo-form has been shown to act as a protein disulfide reductase.

Belongs to the WhiB family.

10.139 kDa

MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA

whiB7

Probable transcriptional regulator WhiB7

92 amino acids

Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity).

Belongs to the WhiB family.

10.139 kDa

MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA