Vps26

Vacuolar protein sorting-associated protein 26

478 amino acids

Component of the retromer complex which acts in conjunction with wingless (wg) and clathrin-mediated endocytosis to sustain a wntless (wls) traffic loop. This loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, thereby enabling wls to direct wg secretion. The hh and dpp signaling pathways do not require the retromer complex suggesting that it does not play a general role in exocytosis.

Belongs to the VPS26 family.

52.656 kDa

MNFLGFGQSADIEIVFDGAEHKTAEVKGEDGKVEKMLLFYDGETVSGKVNVTLKKPGSKLEHQGIKIEFIGQIELYYDRGNHHEFKCLAKALARPGDLIQNNSYPFDFPKVEKQFEVYAGSNVRLRYFLRATIVRRISDITKEVDIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTIIGKIYFLLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPTMRDINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWRKADKPRYHGAQQHQQQQHQHVPLHAPPHLVSGPAAPTVAHSLISSSTDSGEVGGAPTAPGTAGSESKMGLFTRESPNQEFSQQQMDSPPLTPTPSTASVAVAVPTAASSVSEPAPERGIGDGAAAATTSASPVAMLSSSPPPLLPVSPLSRSETEASEQVQPEDEDLDAITPNTKKTGATPLATD

vps26

Vacuolar protein sorting-associated protein 26

349 amino acids

Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. The vps29-vps26-vps35 subcomplex may be involved in cargo selection.

Belongs to the VPS26 family.

40.257 kDa

MNFFSNNFGTPCNVEFELDNCQNRKTIEVTQDKGKTEKLFVFIGNEPVSGKVSINIKEKTKKIEHTGIRVEFVGQIELFYDRGNHYEFTSLVRELAPAGELTENKTFSYDFSNVEKQYESYNGTNVRLRYFVRLTIGRSFASNIVKEYDIWVINFVKPPESNSNIKMEVGIEDCLHIEFEYNKSKYHLKDVIIGKIYFLLVRIKIKYMEIALIKRESTGSGPNVFNESETLTKFEIMDGAPVRGESIPVRLFLSVFDLTPTYRSVHNKFSVKYFLNLALVDEDDKKYFKQQEITLWRRGVTKPGLPGSTNNNNNNNTSNTNNTNTPQQKVTESQNEVPEPENNSSDESD

vps26

Vacuolar protein sorting-associated protein 26

298 amino acids

Plays a role in vesicular protein sorting. Required for the endosome-to-Golgi retrieval of the vacuolar protein sorting receptor pep1/vps10. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. The vps29-vps26-vps35 subcomplex may be involved in cargo selection.

Belongs to the VPS26 family.

35.78 kDa

MDYFFKSPIDVDLHLDNEEERTFVDYEFEQGRKDKAPIYESDETVKGTVMIRLKDGRKLDHDGVKIEFIGQIENTYDKGNIHEFTRSVQELASPGEMRHAQMFEFEFKHVDKPYESYIGKNVKLRYICRVTVSRKMKDVIREKDLWVYRFENEPETNSLIRMDVGIDECLHIEFEYSKNKYHLKDVIIGKIYFILVRIKVQRMEVSIIRRETIGTSPNQYSNSETITRFQIMDGNPNRGETIPLRMFLNGYALTPTFRDVNKKFSVRYYLSLILVDEDQRRYFKQSEITLWRRRDEHE