vps24

Vacuolar protein sorting-associated protein 24

231 amino acids

Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole.

Belongs to the SNF7 family.

26.365 kDa

MQTVRSYFFGPTPQEQNRKWQSIIRKEQRQLDRQVYHLKAGRKKAEVQLKQLAKQSDITNMRILAKEIARANRHGKRLAESKALLGSLSLQLNDQMAMLKIQGTMQSSTKIMQDVSSLIRLPQLSETMRNLSMELTKAGVLEEMRDEMFLPVEDDEELMDLADEDEEVQEILTKYNVIPAPSEKAADAATHREQSLKQALPSLSNGIAKDSTEIDEEQLLDIRDKLDALKS

VPS24

Vacuolar protein-sorting-associated protein 24

224 amino acids

Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole. Acts a component of the ESCRT-III complex, which appears to be critical for late steps in MVB sorting, such as membrane invagination and final cargo sorting and recruitment oflate-acting components of the sorting machinery. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complex assemblies. The DID4/VPS2-VPS24 subcomplex is required for the VPS4-dependent dissociation of ESCRT-III.

Belongs to the SNF7 family.

26.242 kDa

MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKNVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRALQN