vnfG

Nitrogenase vanadium-iron protein delta chain

113 amino acids

The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein (component 2) and a component 1 which is either a molybdenum-iron protein, a vanadium-iron, or an iron-iron protein.

13.364 kDa

MSQSHLDDLFDYTEERCLWQFFSRTWDREENIEGVLGQVARLLTGQEPLRGTPQERLFYADALAMANDVRERFPWASQINHEEIHFLIDGLKSRLVDTVIQSSTNRELNHHLY

vnfG

Nitrogenase vanadium-iron protein delta chain

113 amino acids

The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein (component 2) and a component 1 which is either a molybdenum-iron protein, a vanadium-iron, or an iron-iron protein.

13.379 kDa

MSQSRLDDLFAYVEERCLWQFFSRTWDREENIEGVLNQVCRLLTGQEPLRGTPQERLFYADALAMANDVRERFPWASQVNKEEIAFLIDGLKSRLVDVTITRSTNRELNHHLY

vnfG

Nitrogenase vanadium-iron protein delta chain

113 amino acids

The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein (component 2) and a component 1 which is either a molybdenum-iron protein, a vanadium-iron, or an iron-iron protein.

13.372 kDa

MSQSHLDDLFAYVEERCLWQFFSRTWDREENIEGVLNQVGRLLTGQEPLRGTPQERLFYADALAMANDVRERFPWASQVNKEEIEFLLDGLKSRLVDVTITRSTNRELNHHLY