vma7

V-type proton ATPase subunit F

124 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase F subunit family.

13.807 kDa

MAASAVSYKERQFLAVIGDEDSVTGLLLAGIGHVTDGPDAQRNFLVVDSKTETSAIEKAFQNFTQERKDIAVLLINQHIAERIRHSVDSFADPFPAVLEIPSKDHPYDPEKDSVLKRVRRLFGE

vma7

V-type proton ATPase subunit F

124 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase F subunit family.

13.903 kDa

MAAPASAYKDRQFLAVIGDEDSVTGLLLAGIGHVTSPPDSQKNFLVVDNKTDNAAIEEAFERFTTERKDIGILLINQHIAERIRHRVDTYTAAFPALLEIPSKDHPYDPEKDSVLRRVRRLFGE

vma7

V-type proton ATPase subunit F

120 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase F subunit family.

13.618 kDa

MSSQSYRERTLVSVIGDDDTVTGMLLAGTGQVNENGDKNFFIITQKTTDEQIAEAFDDYTTKRKDIAIVLINQFAAERIRDRIENHVQAFPAVLEIPSKDDPYDPEKDSILRRVRKIIGE

VMA7

V-type proton ATPase subunit F

119 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase F subunit family.

13.64 kDa

MSVDKRTLIAVIGDEDTTTGLLLAGIGQITKETNEKNFFIYEDGKTTKEQILNNFINYTQERQDIAILLINQHIAEKIRSDIDNYTNAFPAILEIPSKDHPYDPEKDSVLKRVRRLFGE

VMA7

V-type proton ATPase subunit F

118 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase F subunit family.

13.461 kDa

MAEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEERDDIAILLINQHIAENIRARVDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE