VMA4

V-type proton ATPase subunit E

233 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase E subunit family.

26.471 kDa

MSSAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPILQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLNKDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD

vma4

V-type proton ATPase subunit E

227 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase E subunit family.

25.742 kDa

MSLSDEQVQAEMHKMVSFIKQEALEKAKEIHTLSEEEFQVEKAKIVREQCDAIDQTYDMKLKRASMAQKIAKSNVLNKSRLEILNSKQKVIDDIFSRVEKKLDGIEQKKDAYTKFMADLIVQAMELLGEPVGIVYSRQRDAEIVKAAIPKATEVLKSKNGSIDYELDAETDDFLNDSVLGGVVLVGLGGKIRVDNTLRARLEIVKEEALPEIRRLLFGENPNRKFDN

VMA4

V-type proton ATPase subunit E

226 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

25.387 kDa

MALSDEQVKSELSKMQAFIEKEAKEKAKEIKLKADEEYEIEKASIVRSETAAIDSTYEQKLKKASLAQQITKSTIGNKTRLRILSTKDEVLHEIFDEAEAELKKITKDKKQYKPVLVGLIEEGVLALMEPKVSIKVREQDVDVAKEAITEAAKNFEEKAKFKVEISIDDKNFLAKDIAGGIVVVNGSGKIEVDNTLEERLKILSEEALPAIRLELFGPSTTRKFFD