virB3

Type IV secretion system protein virB3

116 amino acids

The virB operon is essential for intracellular survival and is not involved in the invasion process. Constitutes a major determinant of virulence in mice.

Belongs to the virB3 family.

13.082 kDa

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

virB3

Type IV secretion system protein virB3

116 amino acids

Belongs to the virB3 family.

13.082 kDa

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

virB3

Type IV secretion system protein virB3

116 amino acids

Belongs to the virB3 family.

13.082 kDa

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

virB3

Type IV secretion system protein virB3

116 amino acids

The VirB system could be required for the establishment of the replication niche in the host.

Belongs to the virB3 family.

13.082 kDa

MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

virB3

Protein virB3

108 amino acids

VirB proteins are suggested to act at the bacterial surface and there play an important role in directing T-DNA transfer to plant cells.

Belongs to the virB3 family.

11.596 kDa

MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARLVVERDYNAASVVLLFLQTAGRSVDGLIWGGASVSPNPIKVPARGRGMA

virB3

Protein virB3

108 amino acids

VirB proteins are suggested to act at the bacterial surface and there play an important role in directing T-DNA transfer to plant cells.

Belongs to the virB3 family.

11.76 kDa

MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARLIVERDYNAASVVLLFLRTAGRSIDSAVWGGATVSPNPIRVPPRGRGMV

virB3

Protein virB3

108 amino acids

VirB proteins are suggested to act at the bacterial surface and there play an important role in directing T-DNA transfer to plant cells.

Belongs to the virB3 family.

11.76 kDa

MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARLIVERDYNAASVVLLFLRTAGRSIDSAVWGGATVSPNPIRVPPRGRGMV

virB3

Type IV secretion system protein virB3

103 amino acids

The type IV secretion system VirB/VirD4 is a major virulence determinant for subversion of human endothelial cell (HEC) function. VirB-dependent changes of HEC include massive cytoskeletal rearrangements, a proinflammatory activation by nuclear factor NF-kappa-B, inhibition of early and late events of apoptosis, leading to an increased cell survival, and, at high infection doses, a cytostatic or cytotoxic effect, which interfers with a potent VirB-independent mitogenic activity. These changes of HEC require the T4S coupling protein VirD4 and at least one of the effector proteins BepA-G. VirB3 may play a role in stabilization of pilus structure.

Belongs to the virB3 family.

11.705 kDa

MNEDPLFLACTRPAMFAGVTMEAMAFNVMATSILFILTSGFTMIGLGIGLHFVLREITKHDHNQFRVLFAWLNTRGKQKNLNRWGGGSTSPLRLIRTYEELNR

virB3

Type IV secretion system protein virB3

103 amino acids

Component of the type IV secretion system VirB/VirD4 which could be a major virulence determinant for subversion of human endothelial cell (HEC) function. VirB3 may play a role in stabilization of pilus structure.

Belongs to the virB3 family.

11.686 kDa

MNEDTLFLACTRPATFAGVTMEGMALNVMATSILFILTSNFTMIGLGIGLHFVLREVTKYDHNQFRVLFAWLNTRGKQKNLTRWGGGSTSPLRLIRTYKELNR