vent1

Homeobox protein vent1

264 amino acids

Transcriptional repressor. Cooperates with vent2 in a ventral signaling pathway downstream of bmp4, which antagonizes the Spemann organizer and dorsal mesoderm formation, and leads to ventral mesoderm formation. Acts downstream of bmp4 to repress transcription of foxa4-B/XFD-1'. Binds to DNA with preference for the target sequence 5'-CTATT[T/C]G-3'. Also binds 5'-TGCATTTTG-3' at a lower frequency, and occasionally 5'-TTGATC-3'. Binds to the homeobox 2 (HBX2) repressor element in the promoter of the myf5 gene and represses myf5 transcription in the ventral domain.

29.978 kDa

MVQQGFSIDLILARSKEEATDGKDSMSSRPHIPCAPQPLPPTKYAKEMPRKKDGQDVQEHTTSFQCSLGEQVINRPSANPSLAAMHRSSGSSDEFSPPGSEDDSTESSGRSSQENDTEQREKSPKSDLQRRLRTAFTPQQISKLEQAFNKQRYLGAPERKKLATSLQLSEIQVKTWFQNRRMKLKRQIQDKQHSLVPPPVCYPQTFPYYPGGFPVPLNSGSFYQPRALPFQAPQHSYIPQPLHHHVRMSSHQEQYPPLFGAQYM

vent1

Homeobox protein vent1

262 amino acids

Transcriptional repressor. Cooperates with vent2 in a ventral signaling pathway downstream of bmp4, which antagonizes the Spemann organizer and dorsal mesoderm formation, and leads to ventral mesoderm formation. Acts downstream of bmp4 to repress transcription of foxa4-B/XFD-1'. Binds to DNA with preference for the target sequence 5'-CTATT[T/C]G-3'. Also binds 5'-TGCATTTTG-3' at a lower frequency, and occasionally 5'-TTGATC-3'. Binds to the homeobox 2 (HBX2) repressor element in the promoter of the myf5 gene (By similarity). Cooperates with vent2 to repress myf5 expression in the ventral domain.

29.802 kDa

MVQQGFSIDLILARNREEAPDGKDSVSSRPHIPCAPQPLAPTKYAKEIPRRKDGQEQGEITSFQCSSEEARNRQFSNPSLPALHRSSGSSDEFSPAGSEDDGTESSGRNSQENDTEHRSKSPKSDLQRRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRRMKLKRQIQDQQHSMVPPPVCYPQTFSYYPGGFPVPLNSGSFYQPPAHPFQAPQHSFIPQPLHHHMRMSAHQEQFPPLFGAQYM