Function
Transcription factor required for both mesoderm and endoderm formation in the embryo; signaling determinants and concentration levels may determine which germ layer is formed. Acts together with beta-catenin to activate genes that are responsible for mesoderm induction including wnt-8, eomes t/bra, siamois, mix1 and sox17. Directly binds to promoter DNA. Patterns the mesoderm along the dorsoventral and posterior axis. Activates siamois gene transcription when alone or in combination with beta-catenin, but inhibits siamois transcription in combination with pou5f1.1/oct-25.
Sequence
MRNCCRERGFSVGRLEPETSFSCASDVKSSPDMDSVSSQDSLYLPNSIGASLEDQNLWTQFHQEGTEMIITKSGRRMFPQCKIRLFGLHPYTKYMLLVDFVPLDNFRYKWNKNQWEAAGKAEPHPPCRTYVHPDSPASGAHWMKDPICFQKLKLTNNTLDQQGHIILHSMHRYKPRFHVVQSDDMYNSPWGLVQVFSFPETEFTAVTAYQNEKITKLKINHNPFAKGFREQERSHKRDDVLKTLQQSPSKSQKRKKWEDSPEADISDFPKATRIKEESIMDPAGVYQNWVSDHEANQGLTPHSPESEGVNQEQQVPTSSSNFYIKSQYRRSSQHLSSPYDLGEPSSRRLTPDVATVPDSDPDSLAVLHVIPTQNSAQERTCSMNFSMETPMKQPLRGAIYSPYGTEQWMVPAQGPYQPVSYTAYPTDLSAQGAVAHPHSGMSDWSQYSLFPYSCW