vax2

Ventral anterior homeobox 2

307 amino acids

Transcription factor that may function in dorsoventral specification of the forebrain. Required for closure of the choroid fissure and together with vax1 is required for optic nerve differentiation and to limit retinal development to the optic cup.

Belongs to the EMX homeobox family.

33.156 kDa

MFDQATSMGDGIAEDRNHCGSNSLCRDRGRESKSRTEVGNRSPVQSSTDTPGTSASTPTSSSEDGHDKLLGVDPDYCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQTKDTDKRSSSTSESLATCNILRLLEQGRLLSVPAPPPNPLLAHPHPGNGSLLGSPSVSTSSGVSSSTTPPGAGSGTFGLSLSSLSGTPPSPRLGVPPPSLCFTMPLLSGAHHELPSGYGCGTSAFEPYMRIERKDGELGGKKTVS

Vax2

Ventral anterior homeobox 2

292 amino acids

Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle. May be a regulator of axial polarization in the retina.

Belongs to the EMX homeobox family.

31.701 kDa

MGDGGAERDRGPKRREEPGGRSGRHGEHRGAEDLRADTGSASPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNVLRLLEQGRLLSVPRAPSLLALTPGLPGLPASHRGTSLVDPRNSSPRLNPMPSASASSPLPPPLPAICFSSAPLLDLPAGYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI

Vax2

Ventral anterior homeobox 2

292 amino acids

Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle (By similarity). May be a regulator of axial polarization in the retina.

Belongs to the EMX homeobox family.

31.706 kDa

MGDGGAERDRGPKRREEPGGRSGCRGEHRGAEDLRADTGSTSPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSAFEAFATSNVLRLLEQGRLLSVPRAPSLLALSPGLPGLTAGHRGTSLGDPRNSSQRLNPMPSASASSPLPPPLPAVCFSAAPLLDLPASYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI

VAX2

Ventral anterior homeobox 2

290 amino acids

Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle (By similarity). May be a regulator of axial polarization in the retina.

Belongs to the EMX homeobox family.

30.874 kDa

MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRLLSVPRAPSLLALTPSLPGLPASHRGTSLGDPRNSSPRLNPLSSASASPPLPPPLPAVCFSSAPLLDLPAGYELGSSAFEPYSWLERKVGSASSCKKANT