About Products Protein Database Contact

ureA2

Gene
ureA2
Protein
Urease subunit gamma 2
Organism
Brucella abortus (strain 2308)
Length
100 amino acids
Function
Disrupting the ure2 operon has no effect on urease activity or pathogen survival in BALB/c mice when administered orally.
Similarity
Belongs to the urease gamma subunit family.
Mass
10.943 kDa
Sequence
MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT

Gene
ureA2
Protein
Urease subunit gamma 2
Organism
Brucella abortus biovar 1 (strain 9-941)
Length
100 amino acids
Similarity
Belongs to the urease gamma subunit family.
Mass
10.943 kDa
Sequence
MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT

Gene
ureA2
Protein
Urease subunit gamma 2
Organism
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Length
100 amino acids
Similarity
Belongs to the urease gamma subunit family.
Mass
10.943 kDa
Sequence
MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT

Gene
ureA2
Protein
Urease subunit gamma 2
Organism
Brucella suis biovar 1 (strain 1330)
Length
100 amino acids
Function
Disrupting the ure2 operon has no effect on urease activity, or pathogen survival in BALB/c mice when inoculated by gavage, but confers slightly enhanced resistance to low pH killing in vitro.
Similarity
Belongs to the urease gamma subunit family.
Mass
10.943 kDa
Sequence
MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT

Gene
ureA2
Protein
Urease subunit gamma 2
Organism
Psychrobacter cryohalolentis (strain K5)
Length
100 amino acids
Similarity
Belongs to the urease gamma subunit family.
Mass
11.025 kDa
Sequence
MQLNPTEKDKLLLFTAGMVAERRKNRGVKLNYPESIAYISMLLMEGARDGKTVAQLMSEGATYLSANDVMEGIAEMIHDVQVEATFPDGTKLVTVHNPIV