Function
Required for the assembly and integrity of muscle dense bodies, which establish the adhesion sites of the muscle cells to the extracellular matrix (PubMed:15210732, PubMed:20385102). Decreased localization of unc-95 to dense bodies and their subsequent dissociation plays an important role in ecdysis during molting (PubMed:20385102). Involved in the organization of the muscle sarcomeric structure and thereby required for locomotion (PubMed:15210732).
Sequence
MTISPQPSHQQFESYQWTTESRSSQQRHGTGTPSQDGRLSAIPDPVERHVARWRSESRNSNKDKVFRNDEEFSQQDEIVNGTLTALKNDVEQTTEIIRRKQEQMRMERRQFQTEMEVNGRISIDPTDDWLAARLKAVSSDDMNQQLVKLKQDQRQNAVTDTLAALVYDVNATTEVLRRGQRGRDGEDGNKKKKEEIEYTLRLTPAPEEQIPQRPKIPEDDNMETDDYSRQYGVQMSEETDSLRRRRARSTTPRRTLHISGSPPPPAAAVCAYCSEEIDGAILTALAPNSERAQKFHTYHFMCTYCQKALNMHGTYREHDLKPYCHDCFYKLYNGLQYAPDDHQASIEKLI