Function
Component of an extracellular matrix cue that guides dorsoventral migrations on the epidermis (PubMed:8861903). Required for the guidance of pioneer axons and migrating cells along the body wall (PubMed:8332188). During gonad morphogenesis, involved in distal tip cell (DTC) migration from the dorsal side of the hermaphrodite body to the midbody to allow for formation of gonad arms (PubMed:22732572). Its association with either unc-40 or unc-5 receptors will lead to axon attraction or repulsion, respectively (PubMed:8332188, PubMed:8861903). Involved in the positioning of ray 1, the most anterior ray sensilium, in the male tail (PubMed:24004945). Required for the formation of synapses between the AVA interneurons and the PHB sensory neurons (PubMed:29742100).
Sequence
MITSVLRYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDPDVSITKSNEQEAVCTASHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTENMQRGETSLWISPQGVICKCPKLRVGRRYLLLGKNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHRY