Function
Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism (By similarity).
Sequence
MSSFNTQNKNVLQTPIPAPTPQSQLKQFVIGGLAGMLSSAFTHPIDSLKVRMQLQGEGTGVGPKRGALKMLVHINQTEGFFTLYKGLSASLLRQATYTTTRFGLYDLIKDIVAKDDKPLPFTQKIMVGMLSGAGGAIVGTPADLTMVRMQADGKLPFNLRRNYKNVFDGIFRISKEEGIISLWKGCSPNLIRAMFMTAGQVSSYDQTKQLMLASGYFHDDIKTHLIASTTAAFVAAVATSPLDVIKTRIMNSPKTVTGELQYKGTFDCLSKTLRAEGFKAFYKGFNPYFMRLGPQTILTFIFVEQLNILWKKSQSYFK