ucp2

Mitochondrial uncoupling protein 2

310 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.573 kDa

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKYRGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSRLMAGCTTGAMAVAVAQPTDVLKVRFQAQVSAGASKRYHSTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVKTRYMNSAQGQYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLGSWNVVMFVTYEQLKRAMMAARQNWHTPL

ucp2

Mitochondrial uncoupling protein 2

310 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.532 kDa

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGESKIPVNTGHGPVKYRGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLMAGCTTGAMAVALAQPTDVVKVRFQAQNSAGANKRYHGTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAPGQYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMMAARHNWATPL

UCP2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.229 kDa

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAACTSREAPF

Ucp2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.374 kDa

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQSREAPF

UCP2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.259 kDa

MVGFKATEVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERRGPVQAAASAQYRGVLGTILTMVRNEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKHFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYRSTVDAYKTIAREEGLRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKADLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAPGQYSSAGHCALTMLQKEGPRAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMAARASREAPF

UCP2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.21 kDa

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVHATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAACTSREAPF

Ucp2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.377 kDa

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCTELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYESREAPF

UCP2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.274 kDa

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPMQAAASAQYRGVLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGAGRRYQSTVEAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKAHLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPQAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAARASREAPF

UCP2

Mitochondrial uncoupling protein 2

309 amino acids

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat (By similarity).

Belongs to the mitochondrial carrier (TC 2.A.29) family.

33.27 kDa

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPVRAAASAQYRGVLCTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGSGRRYQSTVDAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAACTSREAPF