txlA

Thiol:disulfide interchange protein TxlA

191 amino acids

Required for disulfide bond formation in some proteins. Acts by transferring its disulfide bond to other proteins and is reduced in the process.

Belongs to the thioredoxin family.

20.661 kDa

MTADNSVPSRLRNILVIAAALVLTILVVLGSRQPSAAASLASLAEQATPYEVAIANDRPMLLEFYADWCTSCQAMAGRIAALKQDYSDRLDFVMLNIDNDKWLPEVLDYNVDGIPQFVYLNGQGQPQGISIGELPRSVLAANLDALVEAQPLPYTNARGNLSEFSADLQPSRSSQTDPRSHSGQVQDGVLD

txlA

Thiol:disulfide interchange protein TxlA homolog

180 amino acids

Required for disulfide bond formation in some proteins. Acts by transferring its disulfide bond to other proteins and is reduced in the process (By similarity).

Belongs to the thioredoxin family.

19.517 kDa

MTPAKIRNALLAVVAIALSAAVYLGFQTQTQGISLEAQAQRAIPLATALDNGRPTLVEFYADWCTSCQAMAPDLAELKKNYGGSVNFAMLNVDNNKWLPEVLRYRVDGIPHFVYLDDTGTAIAESIGEQPLRVLEQNITALVAHEPIPYANVTGQTSVVENRTIEADPTSPRSHGNPRPS