Protein
Transthyretin-like protein 52
Organism
Caenorhabditis elegans
Function
Plays a role as a bridging molecule that mediates recognition and engulfment of apoptotic cells by cross-linking the surface-exposed phosphatidylserine with the extracellular domain of the phagocyte receptor ced-1. Important for the generation of extracellular phosphatidylserine vesicles that promote loss of the exoplasmic leaflet from apoptotic cells in a time-dependent manner. Required for the exposure of exoplasmic leaflet on the phagocytic cells surrounding the apoptotic cells. Does not affect the phosphatidylserine externalization in living cells. May play a role in mediating transfer of phosphatidylserine from phosphatidylserine vesicles to ced-1 bearing phagocytes or alternatively result in the activation of a phosphatidylserine transporter in the phagocyte that promotes phosphatidylserine externalization.
Similarity
Belongs to the nematode transthyretin-like family.
Sequence
MSRFLIYFLPFFIYSGNVLSKTSCLMATGVLKCPTDPEAVKKVHIDLWDEDSLPLESDDLMGRTWSDRNGNFQVTGCASDFGPINTPDPYLYIQHNCPHRDSNATNPIQIDVIPLFLPSIVRLGNVYLDRYLEDY