trpE

Anthranilate synthase component 1

541 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

59.771 kDa

MRLCTAGRLKQLQGGLVNKAIEIKKLGQLEVLKASVPYTQDPTRLFHTICENKTDSLLLESAEIDSKQNLKSLLIVDSAVRIVCYGHTVSFHALTENGKNLLTHVNQNVRGEVASQFDGETLTLEFIQPCDTIDEDSRLREASSFDALRLVQHSFDLSSQDKHAIFLGGLFAYDLVANFEPLGDAVATNQCPDYVFYVAETLLVVDHQTESCQLQATLFVDGSQKAALESRIEDIRAQCTSPKRLPDATQVANITAQPSVPDQDFCQIVRDLKEFVVKGDIFQVVPSRRFTLPCPSPLAAYKELKQSNPSPYMFYMQDELFTLFGASPESALKYETDTNQIEIYPIAGTRRRGKRPNGEIDFDLDSRIELELRSDKKENAEHMMLVDLARNDVARISQAGTRHVADLLKVDRYSHVMHLVSRVVGQLRDDLDALHAYQACMNMGTLTGAPKIRAMQLIRDVEGARRGSYGGAVGYLTGEGTLDTCIVIRSAYVENGIAQVQAGAGVVFDSDPQAEADETRGKAQAVISAIQAAHSQPANKE

trpE

Anthranilate synthase component 1

531 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

57.369 kDa

MQDLGIISPGLEEFRELAAHSRVIPVRLKVLADAETPIGLYRKLAQGQPGTFLMESAAVGGAWSRYSFIGSRSRATLTTKDGQAHWLGEPPAGVPVDGNPVDAIRDTIEALRTDRFDGLPPFTSGLVGFLGWETVRHWEKLTRPPEDDLQLPELALNLVTDMAVHDNMDGTVLLIANAINFDNSSERVDEAWHDAVARVKELLARISTPVLQPVSVLEPAALDFAASVQERWNEPEYLAALDRGKEAIVDGEVFQVVISRRFEMECGASPLDVYRVLRNTNPSPYMYIFSLEDAAGRQYSIVGSSPEALVTVTGEDVITHPIAGSRPRGKTVDADKALAEELLADQKERAEHLMLVDLSRNDLSKVCVAGSVDVTQFMEVERFSHIMHLVSTVVGRLAPTAKAYDVLKATFPAGTLSGAPKPRALRLLDELEPHRRGIYGGVVGYLDFAGDMDMAIAIRSALLREGRAYVQAGGGIVADSSNPAEAQETVNKAAAPLRAVHTAGSLHNITPDSVSAPDSVSSPDSVTEANS

trpE

Anthranilate synthase component 1

530 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

60.189 kDa

MCEHLKSMDVLKVETFYQPNPTAIFHHICRNRSNTLLLESAEINNKKNLESMMIVDSALRISALNMVVTLEALTKNGESLLPVFKSLLPKEVRILSNDNFLKIKFPSIVKDIDEDKKLHVLSIFDSIRFLINSVKNNKGSKSMFFGGLFAYDLVSSFENLPKLKTSQSCPDFCFYLSEILLVLNHKRRTCYIQASLFSSSNLERNKLQHRLLEVKNKLSQNFYPLESTSLKKMILKCNRTDREYEKIIKEMKKSIMIGEIFQVVPSRKFYLPCTNSLAAYDVLKKNNPSPYMFFMQDSNFTLFGASPESSLKYDTLSRKIEIYPIAGTRPRARKIDGSIDLDLDSRIELEMRTNHKELSEHLMLVDLARNDLAKICDPGTRYVADLTQVDKYSHVMHLVSRVVGKLRLDLDVFHAYQACMNMGTLSGAPKIRAMELISNAEKEKRGSYGGSIGYFTASGTLDMCIIIRSAYVENNIATIQVGAGIVLDSIPQLEVDESKNKAKAVLQAISESHSCHIELNIENERHTFAG

trpE

Anthranilate synthase component 1

529 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

57.031 kDa

MHAHLAATTSREDFRQLAVDHRVVPVTRKVLADSETPLSAYRKLAANRPSTFLLESAENGRSWSQWSFIGVGAPSALTIRDGEAVWLGTVPQDAPTGGDPLHVLQATLELLATAAMPGLPPLSSGMVGFFAYDMVRRLERLPELALNDLQLPDMLLLLATDVAAVDHHEGTITLIANAVNWNGTDERVDQAYDDAIARLDVMTAALGQPLPSTIATFSRPDPRRRAQCTIEEYGAIVDHLVDQIAAGEAFQVVPSQRFEVDTDVDPIDVYRMLRVTNPSPYMYLLHVPNSDGATGFSIVGSSPEALVTVKDGRVTTHPIAGTRWRGQTEEEDQLLEKELLADEKERAEHLMLVDLGRNDLGRVCTPGTVRVEDYSHVERYSHVMHMVSTVTGLLGEGRTALDAVTACFPAGTLSGAPKVRSMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRDGIAYVQAGGGVVADSNGPYEYIEASNKARAVLNAIAAAETLTSLDFGVALAPGRVAARGEAGNQGRL

trpE

Anthranilate synthase component 1

526 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

60.469 kDa

MYYRSIKSEIIQTICTYHEEPSLIFNKICRTKTETLLLESATVHGKKNIESMLIIDTAIKISCFKNIVEIEAISNNGLFLLNTIDLKILKKKSTKIKKKKSNVLEIHFPIFNYFTDEDKKLFLTSVFDALRIIKKSIKNPEKSKMGVFFGGILSYDLISSFEPIPRVFNSKYNHPDFCFYLSENLLIFDHKKKKCKLQTNIFTDNEEEKLNILKRIKIIYNQIKEINSKKKNNRINTFNDFKTKNKKWVDCKNDSKVYKNKVKKMKQMILNGEVFQIVISRKFFLPCPYPLESYIFLKKNNPSPYMFFMQDRHFVLFGASPESSLKFSSITRKIEIHPIAGTRPRAFSSIKKIDINEDNKMELAMRINSKELAEHCMLVDLARNDLSRICLPGSRVVSDLMKVVKYSHVMHLVSKVEGVLRNDLDIFHAYQCCMNMGTLTGAPKIRAMQIIAEEGEIRECYGGAIGYFTGKGDLDTCIVIRSAYVRNGIACVQAGAGIVLDSIADEENEECKNKAMAVINAINKTL

trpE

Anthranilate synthase component 1

524 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

55.915 kDa

MTAPDTDREEFVSLAGDADGPVVTHLVADLDVSVDPLAAYTTLADRSDYGFLLESAEKVSSSNPQGAFSAPATAADSHARFSFVGYDPEAVVTVGPDGVDVTDLGGPAAEFVGAGDGDVLDSLRGALPDLPRVNFPETDRQTLTGGLVGFLAYEAVYDLWLDEVGRERPDTDDPDAEFVLTTRTLSFDHREDAVRLVCTPVVSPDDDPGEVYDGVVAEAERVAEKLRAADDPAPGGFERTGEDAGSREEYEAAVRKTKEHVRDGDIYQGVISRTRKLRGQVDPVGLYASLREVNPSPYMFLLRHGDRRVVGASPETLVSVRGDRVVVNPIAGTCQRGSGPVEDRRLAGELLADAKERAEHTMLVDLGRNDVRRVSTPGSVRVEDFMSIIKYSHVQHIESTVSGTLDADADAFDATRATFPAGTLTGAPKVRAMEIIDDLEAEPRGVYGGGVGYYSWTGDADVAIVIRTATVDSGGADDAITVRAGAGIVADSDPTAEYEETEQKMGGVLDAVRRIEYGTEEASQ

trpE

Anthranilate synthase component 1

524 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.311 kDa

MQTTANHSSRSTQTGTRAHGAALAETTSREDFRALATEHRVVPVIRKVLADSETPLSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPSALTVRDNAAAWLGTAPEGAPSGGDPLDALRATLDLLKTEAMAGLPPLSSGLVGFFAYDMVRRLERLPELAVDDLGLPDMLLLLATDIAAVDHHEGTITLIANAVNWNGTDERVDWAYDDAVARLDVMTKALGQPLTSAVATFSRPAPDHRAQRTMEEYTEIVDKLVGDIEAGEAFQVVPSQRFEMDTAADPLDVYRILRVTNPSPYMYLLNIPDADGGLDFSIVGSSPEALVTVKDGRATTHPIAGTRWRGATEEEDVLLEKELLADEKERAEHLMLVDLGRNDLGRVCRPGTVRVDDYSHIERYSHVMHLVSTVTGELAEDKTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADSNGPYEYTEAANKARAVLNAIAAAATLAEP

trpE

Anthranilate synthase component 1

523 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.118 kDa

MNKAINIKKTAPLEVLHSELPYTQDPTALFHALCAGRSDCLLLESAEIDSKQNLKSLLLVDAAVRIVCEGHQVTYHALSANGQALLNIIHSNLTDRIPCKVEKAKLTLTFSTPCDTLDEDSRLREASSFDALRLVQHSFDLTDHGKFALFLGGLFAYDLVANFEPLGEAPADNQCPDYVFYVAETLMVIDHQRETCQLQATQFQPGDALHSQLKSRMREIRAQVNQKLPLPSAQSLSDVEVTTNISDAAFCDIVRDLKQYVVKGDVFQVVPSRRFRLPCPSPLAAYQRLKQSNPSPYMFYMQDERFTLFGASPESALKYEMHTNQVEIYPIAGTRRRGKRADGSIDFDLDSRIELELRTDKKENAEHMMLVDLARNDVARISQAGTRHVADLLQVDRYSHVMHLVSRVVGQLREDLDALHAYQACMNMGTLTGAPKIRAMQLIRDVEQARRGSYGGAVGYLTGEGDLDTCIVIRSAYVENGIAQVQAGAGVVYDSDPQAEADETRGKAQAVISAILYAHQGKE

trpE

Anthranilate synthase component 1

522 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

59.507 kDa

MKKNLISIDVFLTETRYQPNPTAIFNQICKKKSETLLLESAEINKKHHLESMMIIDAALKISFLNQIVIVEALTKNGVNLLSVFKSLLPKNVIILSDNNPLEIKFPILSMYLDEDQRLRSLSVFDAIRFLIKSVKNLSEFAPKSMFFGGLFSYDLITSFENLPILNTHQHCPDFCFYLSETLLILDHKNKTSIVQVTSFTNDNFEKKRLKDRLEILKNKLSKNLCPIKFDTLKNMKLWCNKTDEEYNKIIVNVKKFILQGEIFQVVPSRKFYLSCVNPLSSYEVLKKNNPSPYMFFMQDRKFTLFGASPESALKYDINSRQIEIYPIAGTRPRGRRSDGSLDLDLDNRIELEMRTNNKELAEHLMLVDLARNDLAKICEPGTRHVADLIRVDRYSHVMHLVSRVIGKLRFDLDFLHAYQACMNMGTLTGAPKVRAMELISEIEGEKRGSYGGAIGYFTGLGMLDTCIVIRSAYVENKIATIQAGAGIVLDSVPQLESDESKNKAKAVIQAIANSHSCQIEYL

trpE

Anthranilate synthase component 1

521 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.793 kDa

MFLIEKRRKLIQKKANYHSDPTTVFNHLCGSRPATLLLETAEVNKKNNLESIMIVDSAIRVSAVKNSVKITALSENGAEILSILKENPHKKIKFFEKNKSINLIFPSLDNNLDEDKKIFSLSVFDSFRFIMKSVNNTKRTSKAMFFGGLFSYDLISNFESLPNVKKKQKCPDFCFYLAETLLVVDHQKKTCLIQSSLFGRNVDEKNRIKKRTEEIEKKLEEKLTSIPKNKTTVPVQLTSNISDFQYSSTIKKLQKLIQKGEIFQVVPSRKFFLPCDNSLSAYQELKKSNPSPYMFFMQDEDFILFGASPESSLKYDEKNRQIELYPIAGTRPRGRKKDGTLDLDLDSRIELEMRTNHKELAEHLMLVDLARNDLARICEPGSRYVSDLVKVDKYSHVMHLVSKVVGQLKYGLDALHAYSSCMNMGTLTGAPKVRAMQLIAEYEGEGRGSYGGAIGYFTDLGNLDTCITIRSAYVESGVATIQAGAGVVFNSIPEDEVKESLNKAQAVINAIKKAHFTMGSS

trpE

Anthranilate synthase component 1

520 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

59.502 kDa

MKNRRYEVEILQIEGIYQSDPTTIFNQLCNKKKCTLLLESAEIDKKHALESMIIIDSALRISSLDNIVTIEALTENGKSLLFKLDLLLPLTVKNVLFENSRRLIFPFINHEIDEDKKLRSVSIFDTFRLLIKTMKIPKNLTKSMFFGGLFSYDLVNNFEKLPILNRNQKCPDLCFYLAETLLILDHKKKNCIIQSSLFNRKSSEKNRLKKNLQEIKTKLTQNVPKIEHRKIDQISLKCNLTDKEYIKIIKKMKQSIKKGDIFQVVPSRKFYLPCISSLSAYQRLKQSNPSPYMFFMQDSDFTLFGASPESSLKYDSKSKKIEIYPIAGTRPRGKTENGLIDLDLDSKIELEMRMNEKELSEHLMLVDLARNDLARICEPGSRYVASLTKVDRYSCVMHLVSKIVGRLKSNLDIFHAYCACMNMGTLTGAPKIKAMELISKFEKERRGSYGGSIGYFTESNNFDTCIIIRSAYVENNLATVQAGAGIVLDSVPQEEANESRNKAQAVIQAIIYAHSSREVV

trpE

Anthranilate synthase component 1

520 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia.

Belongs to the anthranilate synthase component I family.

57.088 kDa

MQTPKPTLELLTCDAAYRENPTALFHQVCGDRPATLLLESADIDSKDDLKSLLLVDSALRITALGDTVTIQALSDNGASLLPLLDTALPAGVENDVLPAGRVLRFPPVSPLLDEDARLCSLSVFDAFRLLQGVVNIPTQEREAMFFGGLFAYDLVAGFEALPHLEAGNNCPDYCFYLAETLMVIDHQKKSTRIQASLFTASDREKQRLNARLAYLSQQLTQPAPPLPVTPVPDMRCECNQSDDAFGAVVRQLQKAIRAGEIFQVVPSRRFSLPCPSPLAAYYVLKKSNPSPYMFFMQDNDFTLFGASPESSLKYDAASRQIEIYPIAGTRPRGRRADGTLDRDLDSRIELDMRTDHKELSEHLMLVDLARNDLARICTPGSRYVADLTKVDRYSYVMHLVSRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADETRNKARAVLRAIATAHHAQETF

trpE

Anthranilate synthase component 1

520 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia.

Belongs to the anthranilate synthase component I family.

57.494 kDa

MQTQKPTLELLTCEGAYRDNPTALFHQLCGDRPATLLLESADIDSKDDLKSLLLVDSALRITALGDTVTIQALSGNGEALLALLDNALPAGVESEQSPNCRVLRFPPVSPLLDEDARLCSLSVFDAFRLLQNLLNVPKEEREAMFFGGLFSYDLVAGFEDLPQLSAENNCPDFCFYLAETLMVIDHQKKSTRIQASLFAPNEEEKQRLTARLNELRQQLTEAAPPLPVVSVPHMRCECNQSDEEFGGVVRLLQKAIRAGEIFQVVPSRRFSLPCPSPLAAYYVLKKSNPSPYMFFMQDNDFTLFGASPESSLKYDATSRQIEIYPIAGTRPRGRRADGSLDRDLDSRIELEMRTDHKELSEHLMLVDLARNDLARICTPGSRYVADLTKVDRYSYVMHLVSRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIAEAEGRRRGSYGGAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGVVLDSVPQSEADETRNKARAVLRAIATAHHAQETF

trpE

Anthranilate synthase component 1

519 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

59.521 kDa

MEKKPYEIKIIQKKAKYHPDPTIVFNHICGSQKQTLLLETAEINKKNDLESIMIIDAALRISSERNHSVQLTALSKNGENILSILKSNLKQKVQMFIQDTSIRLEFPHFQKNLDEDKKIFSLSIFDTFRFIMKFFKNRNKVQKAMFFGGLFSYDLISNFELLPKLKKTQKCPHFCFYLAETLLIVDHQKKTCLIQNSLFTKNSHEQMRVEKRGREIQKKLEASLNSIPVRQEVKNSMLTANMSDEQYCSIIKKLQILIRKGEIFQVVPSRKFFLPCSNPLSAYQKLKKSNPSPYMFFMQDKDFTLFGASPESSLKYDDTTRQVELYPIAGTRPRGRNMDGTLNLDLDSRIELEMRTNHKELAEHLMLVDLARNDLARICEPGSRYVSDLVRVDKYPHVMHLVSRVVGTLKPELDALHAYAACMNMGTLTGAPKIRAMELIAEYEMEQRGSYGGAIGYFTDLGNLDTCITIRSAYVEDNIATIQSGSGIVYNSIPEDEVKEGINKAKRVINAIQHAHHLV

trpE

Anthranilate synthase component 1

519 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (Probable).

Belongs to the anthranilate synthase component I family.

57.658 kDa

MNTKPQLTLLKVQASYRGDPTTLFHQLCGARPATLLLESAEINDKQNLQSLLVIDSALPITALGHTVSVQALTANGPALLPVLDEALPPEVRNQARPNGRELTFPAIDAVQDEDARLRSLSVFDALRTLLTLVDSPADEREAVMLGGLFAYDLVAGFENLPAVRQDQRCPDFCFYLAETLLVLDHQRGSARLQASVFSEQASEAQRLQHRLEQLQAELQQPPQPIPHQKLENMQLSCNQSDEEYGAVVSELQEAIRQGEIFQVVPSRRFSLPCPAPLGPYQTLKDNNPSPYMFFMQDDDFTLFGASPESALKYDAGNRQIEIYPIAGTRPRGRRADGSLDLDLDSRIELEMRTDHKELAEHLMLVDLARNDLARICQAGSRYVADLTKVDRYSFVMHLVSRVVGTLRADLDVLHAYQACMNMGTLSGAPKVRAMQLIAALRSTRRGSYGGRVGYFTAHRHLDTCIVIRSAYVEDGHRTVQAGAGVVQDSIRRREADETRNKARAVLRAIATAHHAKEVF

trpE

Anthranilate synthase component 1

518 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.384 kDa

MSTNPHVFSLDVRYHEDASALFAHLGGTTADDAALLESADITTKNGISSLAVLKSSVRITCTGNTVVTQPLTDSGRAVVARLTQQLGQYNTAENTFSFPASDAVDERERLTAPSTIEVLRKLQFESGYSDASLPLLMGGFAFDFLETFETLPAVEESVNTYPDYQFVLAEIVLDINHQDQTAKLAGVSNAPGELEAELNKLSLLIDAALPATEHAYQTTPHDGDTLRVVADIPDAQFRTQINELKENIYNGDIYQVVPARTFTAPCPDAFAAYLQLRATNPSPYMFYIRGLNEGRSYELFGASPESNLKFTAANRELQLYPIAGTRPRGLNPDGSINDELDIRNELDMRTDAKEIAEHTMLVDLARNDLARVSVPASRRVADLLQVDRYSRVMHLVSRVTATLDPELDALDAYRACMNMGTLTGAPKLRAMELLRGVEKRRRGSYGGAVGYLRGNGDMDNCIVIRSAFVQDGVAAVQAGAGVVRDSNPQSEADETLHKAYAVLNAIALAAGSTLEVIR

trpE

Anthranilate synthase component 1

518 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

57.522 kDa

MNIQTQAFIAVTAQPIPYYADTTAIFNTLCQSNSNSLLLDSAEIGSKNSLQSLILVNAAVKITCLGHNVTFKALNNNGKQVLKEIHPKLTALGKVSAVNFEDEFSVQFLPLDNQLDEDSKLQSATIFDGLRVISSLYQHSQTPIFLGGLFAYDLVANFIPMDGITLKNDGINCPDYSFYLAEHLITIDHQNQQATLKSFCFAQEEQVNIAKTSLSIAQKLKNIDHVLSIKAASDEVKTNFDDPEFTGIVKALKHHINIGDVFQIVPSRRFSLACPNTLASYAQLKQNNPSPYMFYMNDEDFILFGASPESALKYAPENRQLEIYPIAGSRPRGFDAHGNIDPELDARLELELRLDHKEQAEHLMLVDLARNDIARVCQSGTRKVAELMQVDRYSHIMHLVSRVVGKLRPELDALHAYQACMNMGTLTGAPKIKAMQLIYQFEQQKRHSYGGAVGYLTSDGHFDTCIVIRSAFVQNGMAHVQAGCGEVLDSDPQMEADETRHKAAAVLKAIRQVNTQAK

trpE

Anthranilate synthase component 1

516 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

55.849 kDa

MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEPGLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIANAVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIVEYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFSIVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGRNDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADSNGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC

trpE

Anthranilate synthase component 1

516 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

55.849 kDa

MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEPGLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIANAVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIVEYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFSIVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGRNDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADSNGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC

trpE

Anthranilate synthase component 1

516 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

55.849 kDa

MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENGRSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEPGLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIANAVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIVEYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFSIVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGRNDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAPKVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADSNGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC

trpE

Anthranilate synthase component 1

515 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.116 kDa

MNFQSNISAFLEDSLSHHTIPIVETFTVDTLTPIQMIEKLDREITYLLESKDDTSTWSRYSFIGLNPFLTIKEEQGRFSAADQDSKSLYTGNELKEVLNWMNTTYKIKTPELGIPFVGGAVGYLSYDMIPLIEPSVPSHTKETDMEKCMLFVCRTLIAYDHETKNVHFIQYARLTGEETKNEKMDVFHQNHLELQNLIEKMMDQKNIKELFLSADSYKTPSFETVSSNYEKSAFMADVEKIKSYIKAGDIFQGVLSQKFEVPIKADAFELYRVLRIVNPSPYMYYMKLLDREIVGSSPERLIHVQDGHLEIHPIAGTRKRGADKAEDERLKVELMKDEKEKAEHYMLVDLARNDIGRVAEYGSVSVPEFTKIVSFSHVMHIISVVTGRLKKGVHPVDALMSAFPAGTLTGAPKIRAMQLLQELEPTPRETYGGCIAYIGFDGNIDSCITIRTMSVKNGVASIQAGAGIVADSVPEAEYEESCNKAGALLKTIHIAEDMFHSKEDKADEQISTIVR

trpE

Anthranilate synthase component 1

515 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.687 kDa

MSKNPYEIEIIQKTAPYHPDPTMIFNHLCASRPGTLLLETAEVNKKRDLESIMIIDSAMRISSEDNSVKLTPLSINGTDILSTLKKTIPKKIEIYEKNNSTILVFPKIKKNIDEDKKLFSLSVFDAFRLMIRIFENREKKSKAMFFGGLFSYDLISVFESLPKLKGNQKCSNFCFYLAETLLVLDHQKKTCLIQNSLFSKNLKERKRIKKRSVEIERKLNEKLKLIPKTKIKDINLTSNMNNFEYGTIIKKLQKLIQKGEIFQVVPSRKFYLPCPNPLSAYQKLKKSNPSPYMFFMQDQDFTLFGASPESSLKYDEKTRKIELYPIAGTRPRGKTEDGNLDLDLDSRIELEMRTNHKELAEHLMLVDLARNDLARICKPGSRYVSDLVRVDRYSHVMHLVSRVIGELREGLDALHAYASCMNMGTLTGAPKVRAMQLIAEHEGEKRGSYGGAIGYFTDLGNLDTCITIRSAYVEKQVATIQAGAGIVYNSIPENEVNESLNKAQAVINAIKNAHY

trpE

Anthranilate synthase component 1

514 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.772 kDa

MKKKPYQIEIIQKKAPYHPDPTMIFNHLCESRSATLLLETAEVNKKKDLESIMIIDSAIRISSKKNLVKLKPLSINGEEILLALKKRIPKKIEIYEKNKNIILVFPKIEKNLDEDKKLFSLSVFDAFRFMIKIFENKEKKSKAMFFGGLFSYDLSQFFESLPKLKGNQKCSNFCFYLAETLLVLDHQKKTCLIQNSLFTKNANEKKRIKERSIEIEKKLNEKLKSIPKVKITDINLTSNMNNFEYGSIIKKLQKLIQKGEIFQVVPSRKFYLPCPNPLSAYQKLKKSNPSPYMFFMQDKDFTLFGASPESSLKYDEKTRKIELYPIAGTRPRGRTEDGNLDLDLDSRIELEMRTNHKELAEHLMLVDLARNDLARICKPGSRYVSDLVKVDKYSHVMHLVSKVIGELKEGLDALHAYASCMNMGTLTGAPKVRAMQLIAEYEKEKRGSYGGAIGYFTDLGNLDTCITIRSAYVENIATIQAGAGIVYNSIPEDEVNESLNKAQAVINAIKNAHY

trpE

Anthranilate synthase component 1

514 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.985 kDa

MKKSAYPIEIIQKQAPYHPDPTMIFNHLCESRSETLLLETADNKKKRSRKIMIIDSAMRISSEHNAVKLTPLSINGMEILLVLKKIISKKIEIYRRKKNTILIFPNIEKDLDEDKKLFSLSVFDAFRLIIKTFENREKKSKAMFFGGLFSYDLISVFETLPKLKGNQKCSNFCFYLAETLLVLDHQQKTCLIQSSLFTKNSNEKKRIEERSVEIKQKLNQKLNSIPKIKIKDINLTSNMNNFEYGSIIKKLQKLIQKGEIFQVVPSRKFYLPCPNPLSAYQKLKKSNPSPYMFFMQDQDFTLFGASPESSLKYDEKTRKIELYPIAGTRPRGRTKDGNLDLDLDSRIELEMRTNHKELAEHLMLVDLARNDLARICKPGSRYVSDLVRVDRYSHVMHLVSRVIGELREGLDALHAYASCMNMGTLTGAPKVCAMQLIAEYEKEKRGSYGGAIGYFTDLGNLDTCITIRSAYVEKRYCYNQAGAGIVYNSIPEDEVNESLNKAQAVINAIKNAHY

trpE

Anthranilate synthase component 1

513 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

58.091 kDa

MNSQSNLTQFLKDSESYKTIPIVETITVDTLSPIQIVEKLKQDIVYLLESKDESSSWSRYSFIGLHPFLTLHDDQNKYIARDAAGQKLMQKQELKELLDWMKEQYQIKTPDIDIPFTGGAVGYLSYDLIPTLTSVRPHRSASTIENAHICLPTMIAFDHETNHVHFIQYTQLTGHETEDEKIRAYKEKQKQLEQMIHKLHSKVDMKELILSGNMNEPPSFEHVTSTYEKAQFLKDVEKIKEYIRAGDIFQGVLSQRFDIPVSVSSFELYRVLRIVNPSPYMYFMKLKDRDLVGSSPERLIHAKNGHLEIHPIAGTRKRGTTREEDAELARELLEDEKEKAEHYMLVDLARNDVGRVAEYGSVSVPTFTKVVNFSHVMHIISIVTGKLKRDTHPVDALMSAFPAGTLTGAPKIRAMQLLNEMEPEPRETYGGCIAYIGFDGNIDSCITIRTMSVKNHTASIQAGAGIVADSVPENEWEETCNKAGALLKAIQLAEHIFSEKESVQDESPTISSC

trpE

Anthranilate synthase component 1

511 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.829 kDa

MTTHAAEAPTTDPQGAPGSQKTPDATEAEEAARATVPHRAAAAALAREHDVVPLHQEFLDDSVSPVTAFAQLCGPDEAGFLLESVPVSGGVARYSYVGHRPVPLEPTGGDPLTALRSHLARSVAPVPGLPPFHGGVVGYLGYEAARHFEDLPLAAGPPPGLPESAFLAADDLVVFDHATRRVLLMTLYRPARESYDDAVARIVRLNRALRRAPAPAAFSGRPLAAATPADHGTQGWTANLTEAQFTERVARAREHIAAGDAFQIVLSRRLSRPLRARPTDLYRHLRATNPSPYMYHLSLGGGRHVIGASPELLVKAEGRTVRTRPLAGTRPRHPDPAEDLRLERELRADEKERAEHVMLVDLGRNDLGRVTEPGTVRVERLMRVERFSHVMHLSSTVRGRLAEGRDALDALRSAFPAGTLSGAPKIRAMEIIAELEPEQRGVYGGALGFVGADGLTDFAIALRTMVVADGHVHVQAGAGIVADSDPAAEFRETLHKSRAMLTAVRRAEAAA

trpE

Anthranilate synthase component 1

508 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.493 kDa

MSADGLAAFLAEANEFRTIPIVRKFVADVIEPLGVFANLREEAVFLLESKDDESPWARYSFIGVAPFLTLESETGETFSVKDENGNEQITAPTLKEAFQWVERTLAVKPLAETVPFTGGAVGFLGYDFISAIEKVPRHKNRDVPMKTAYFVFCESLFAFDQKKRELLVIHYIRLSGNETEEEKIEAYRAAERRMADLAAKAARPQAEQPLLPAESESGRTASFAKAVSNYDKKQFLRDVEAVKRYIAAGDVFQAVLSQRFCVPVQAGGFAIYRLLRYINPSPYMFYFQLDGVEIVGSSPEKLIQVHRRRVEIDPIAGTRRRGRSPEEDERLADELYHDPKERAEHYMLVDLARNDIGRVAKYGTVEVPVLLQIGKFSHVMHLISKVVGELDDNVHPIDALLAAFPAGTVSGAPKVRAMQILQELEPTARGLYAGAIAYIGFDGNIDSCIAIRTAVVKDGYAYVQAGAGIVADSVPELEWKETRNKASALMNAIEQAERLFAKGERAVC

trpE

Anthranilate synthase component 1

508 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

57.147 kDa

MISPGFSHFTELAQQGNFIPVYQEWVADLETPVSAWYKVCSSQPYNFLLESVEGGESIGRYSFLGCDPMWVLEARGDETTQVLRNGQTETFRGNPLDILSQCLESIRPVNLPQLPPGIGGLFGVWGYELIRWMEPRVPVYEPQPEDPPDGIWMQVDHLLIFDQVKRKIWAIAFADLRGENVDLETAYRNACQRVTKLVLQLQLPLPPEATALELLTKTQLEGKELNYSSNTEQEKFLEEVAIAKDYITAGDIFQVVLSQRLSTIYRDDPFKLYRSLRLINPSPYMAYYNFGHWQIIGSSPEVMVKADRQLDGKLMATVRPIAGTRPRGKTHPEDEQLAEELLNDPKEIAEHVMLVDLGRNDLGRVCVQGSVKVNELMVIERYSHVMHIVSNVVGELASDKTAWDLLKACFPAGTVSGAPKIRAMEIINELEPERRGPYSGVYGYYDFEGQLNTAIAIRTMVVQEQPDGAHRVSVQTGAGIVADSDPQKEYEETLNKARGLLEAIRALS

trpE

Anthranilate synthase component 1

508 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.441 kDa

MSIDRLAAFLADARQFRTIPIMRKFLADVIEPLQVFANLREEAVFLLESKDDESPWARYSFIGVAPFLTLESETGETFLIKDENGNVQMTASTLKEAFQAVERALCVKPLAEAAPFTGGAVGFLGYDFISAIEKVPRHRAPDLAMKAGHFVFCESLFAFDHEKRELSLIHYIRLKGHETMQEKIAIYRAAEERIAALAAKASRPRAEQPLLPAEDEAERAALFSKASSNYEKEQFLRDVEAVKQYIAAGDVFQAVLSQRFSVPVQAGGFAIYRILRHINPSPYMFYFRLDGIEIVGSSPEKLIQVRNRRAEIDPIAGTRRRGRSPAEDEKLADELYHDPKERAEHYMLVDLARNDIGRVAKYGTVEVPVLMEIGKFSHVMHLISKVVGVLDDDIHPIDALLAAFPAGTVSGAPKVRAMQILQELEPTARGLYAGAIAYIGFDGSIDSCIAIRTAVIKDGYAYVQAGAGIVADSVPELEWKETRNKASALIYAIEQAERLFAKGEQIVC

trpE

Anthranilate synthase component 1

505 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.084 kDa

MNREEFLRLAAEGYNRIPLARETLADFDTPLSIYLKLADQPNSYLLESVQGGEKWGRYSIIGLPCRTVMRVHGHHVSVTHDGVEIESLDVEDPLDFVETFKARYNVPTIAGLPRFNGGLVGYFGYDCVRYVEKRLANCPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAQQDAYARGVAQLDELMHKLRQPITPRRGLDLDRAPRADPVFRSSFTQGDYEAAVDTIKQYILAGDVMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNLITVRPIAGTRPRGATEEADLALEEDLLSDHKEIAEHLMLIDLGRNDVGRVSEIGTVKLTEKMVIERYSNVMHIVSNVTGQLKNGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYMAWNGNMDTAIAIRTAVIKNGELHVQAGGGIVADSVPVLEWEETLNKRRAMVGSAWWPWPRRLPRVEQACCSGNER

trpE

Anthranilate synthase component 1

500 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.909 kDa

MTSFESFERGWKAGQNQIVYARLTADLDTPVSLMLKLAEARTDTFMLESVTGGEIRGRYSVVGMKPDLIWQCHGQDSRINREARFDRQAFQPLEGHPLETLRALIAESRIEMPADLPPIAAGLFGYLGYDMIRLVEHLPGINPDPLGLPDAVLMRPSVVAVLDGVKGEVTVVAPAWVSSGLSARAAYAQAAERVMDALRDLDRAPPAQRDFGEVAQVGEMRSNFTHEGYKAAVEKAKDYIRAGDIFQVVPSQRWAQDFRLPPFALYRSLRKTNPSPFMFFFNFGGFQVVGASPEILVRLRDREVTVRPIAGTRKRGATPEEDRALEADLLSDKKELAEHLMLLDLGRNDVGRVAKIGTVRPTEKFIIERYSHVMHIVSNVVGEIAEGEDALSALLAGLPAGTVSGAPKVRAMEIIDELEPEKRGVYGGGVGYFAANGEMDFCIALRTAVLKDETLYIQSGGGVVYDSDPEAEYQETVNKARALRRAAEDAGLFARRAGNG

trpE

Anthranilate synthase component 1

500 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.587 kDa

MISLIEKAPYIPYPLALYEKLEQRHTLLFESAEIESKAHTKSLLMAKACLKLVCNHNIVTITSLTPNGGAFLQTLSAFFKTPIQDNALTLTYTKDKKIQDEFLKLFEPSPFDALRGLFKSVKTRPKHPFTLFSAGVFSFEMLNFFEDLPHLKANDNTANDFIFYVAQNLIIIDHKEKSAEILGACFDERFKTEIAKELQDLKELVKNIKSDFIPKKAKQSIEVSVSCDDSEFEKKVLFLQEEIKKGEIFQAVLSRSFYMECLEGLSAYYHLKLSNPSPYMFYIKDSDFILFGASPESALKYNALTNTAEIYPIAGTRLRGKDKQGNIDYDLDSKMEFDLQHDYKERAEHIMLVDLARNDMARVSKKRYCDKLLKVDKYSNVMHLVSRVVGELKKGCDSLHAYRSFMNAGTLSGAPKISAIKLIYQLENQRRGSYGGSVGYLNSEGSMDSCITIRSCFVKNNRAVIQAGAGIVLDSVPQNEANETRAKVQALIDAIRKTIS

trpE

Anthranilate synthase component 1

500 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.556 kDa

MISLIEKAPYIPYPLALYEKLEQPHTLLFESAEIESKAHTKSLLMAKACLKLICNHNIVTITSLTPNGGAFLQKLSAFFKTPIQDNALILTYTKNKKTQDEFLKLFEPSPFDALRGLFKSVKTKPKHPFTLLSAGVFSFEMLNFFEDLPHLKAKDNTVHDFIFYLAQNLIIIDHKEKSVEILGACFDERFKTEIAQELQDLKELAKSIKSDFVPKKSKQSREVSANCSDSEFEKRVLSLQEEIKKGEIFQAVLSRSFYMECLEGLSAYYHLKLTNPSPYMFYIKDSDFILFGASPESALKYNALTNTAEIYPIAGTRLRGKDKQGNIDYDLDSKMEFDLQHDYKERAEHIMLVDLARNDMARVSKKRYCDKLLKVDKYSNVMHLVSRVVGELKKGCDSLHAYRSFMNAGTLSGAPKISAIRLIYQLENQRRGSYGGSVGYLNSEGSMDSCITIRSCFVKNNRAVIQAGAGIVLDSVPQNEANETRAKAQALIDAIRKTSL

trpE

Anthranilate synthase component 1

497 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

55.386 kDa

MTSLTQFEQLKTAGYNTIPVYRQRLADTDTPLSVFARLKDYTQAYLFESVEGGENWARYSIIGLGESTVFSCNAGQLTIKNAQGNITTQSCADPFQYIRDYQSQFKVPPHALIPDLPQFTGGLVGYFGYDAVRYIEPRLSNVPEADPVGLPDIWMMLSKTVIIFDNLKDTLFLIVHANTTDEEAYQRAQNQLDYLERLLATPVSLQAKKHKAPHFESLTGKEKFLESVETVKEYIRAGDVMQVVPGHRMVSDFDGDPLQVYRALRHLNPSPYLFLVQGHTLTDNTPFHIVGSSPEILSRLEDGIATVRPLAGTRPRGKTKEEDLALEQELLADEKEIAEHLMLIDLGRNDVGRVSKIGKVQVTDRMVIERYSHVMHIVSNVQGEVRDDIDALDVFKATFPAGTLSGAPKIRAMEIIDEVEPVKRGIFGGAVGYLGWHGEMDMSIAIRTCVIRENKVYVQAGAGLVADSNPESEWNETQIKARAVIKAVELSSNGLIL

trpE

Anthranilate synthase component 1

494 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

57.087 kDa

MNLNLSLEEVRKLSENYNVIPLYTELLVDTETPLSIFLKLKEKGQFNILLESAEGGEKWGRYSFIITGSSFYLRTRKDIGEIYERGKVNFFETKDPLSKIKEVVKKFIPYHDERLPRFWGGLVGYFAYDVVKFYEPVEDKNPDPIHTYDIYLVLTDVVVIHDNLTGKIKVVVPIFAQNGIEEEYERAKNLIRDTVKKLKERGTTFLNVVEKEPDFKNWRSNFTKEEFEDIVKKAKEYIAQGDVIQVVLSQRFRKRFKGNPDNIYRVLRFLNPSPYMYYLDFDQLKVIGSSPEILVRLEEGRIETRPIAGTRKRGRTEEEDKRLEEDLLSDEKERAEHLMLVDLARNDIGRVAKTGSVRVENFMRIERYSHVMHIVSDVVGELREGYDALDVLKATFPAGTVSGAPKVRAMQIIEELENERRGIYAGSVGYISFQGNMDMAIAIRTAVYRDRDIFVQAGAGIVADSVPEKEWEETVNKAKALMKAIEIAEESQEE

trpE

Anthranilate synthase component 1

494 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

56.02 kDa

MFYPTLDEVKIMAKDYNIIPVTMEVYADMETPISLFKRFEESSCCFLLESVEGGEKWARYSIIGKNPFLVVESYKNKTIIRERNGSQREVEGNPVEIIKGIMGKFKGANLPNLPRFNGGAVGYFGYDLIRHYENLPNVPEDDMGLPECHFMFTDEVLVYDHLKQKIHIIVNLHVNGNIERAYISAVDRIKTIHREILDTRWKTADNSVLSYNKKKNELAVTSNISKEDFCRNVLKAKQYIRDGDIFQVVLSQRLCVETNENPFNIYRALRVINPSPYMYYLKFGGYRIIGSSPEMLVRVENGIVETCPIAGTRKRGRTKEEDEALEKELLSDEKEIAEHVMLVDLGRNDIGRVSKFGTVAVKNLMHIERYSHVMHVVTNVQGEIREDKTPFDALMSILPAGTLSGAPKVRAMEIIDELETVKRGPYGGAIGYLSFNGNLDSCITIRTIILKDGKAYVQAGAGIVADSVPEREYEECYNKAMALLKAIEEAGEIR

trpE

Anthranilate synthase component 1

493 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia.

Belongs to the anthranilate synthase component I family.

54.449 kDa

MNREEFLRLAAVGYNRIPLACETLADFDTPLSIYLKLADQPNSYLLESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILHDGVEVESHDVEDPLAFVESFKDRYKVADIPGLPRFNGGLVGYFGYDCVRYVEKRLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAEEQAFEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPEFRSSYTREDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVINDGELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQTSAK

trpE

Anthranilate synthase component 1

492 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia.

Belongs to the anthranilate synthase component I family.

54.555 kDa

MNREEFLRLAADGYNRIPLSFETLADFDTPLSIYLKLADAPNSYLLESVQGGEKWGRYSIIGLPCRTVLRVYDHQVRISIDGVETERFDCADPLAFVEEFKARYQVPTVPGLPRFDGGLVGYFGYDCVRYVEKRLATCPNPDPLGNPDILLMVSDAVVVFDNLAGKIHAIVLADPSEENAYERGQARLEELLERLRQPITPRRGLDLEAAQGREPAFRASFTREDYENAVGRIKDYILAGDCMQVVPSQRMSIEFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDGLVTVRPIAGTRPRGINEEADLALEQDLLSDAKEIAEHLMLIDLGRNDVGRVSDIGAVKVTEKMVIERYSNVMHIVSNVTGQLREGLSAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYLAWNGNMDTAIAIRTAVIKNGELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQSVE

trpE

Anthranilate synthase component 1

491 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.719 kDa

MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYSFIGLPCSHYLKASGKHVDVYQNGEIVEQHDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLVGYFGYETIYNFEHFAHRLKNTTKADPLGTPDILLMLSQELAVVDNLSGKIYLIVYADPSQPDGYERARERLEDIRTQLRQSCAIPLSLGSKHTEAVSEFGEEPFKACVNKIKDYIFAGDCMQVVPSQRMSMEFTDSSLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERDDVIVRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKMVIEKYSHVMHIVSNVEGRLKDGMTNMDILAATFPAGTLSGAPKVRAMEIIEEVEPSKRGIYGGAVGVWGFNNDMDLAIAIRTAVVKNNTLYVQSGAGVVADSDPASEWQETQNKARAVIHAAQMVQEGLDK

trpE

Anthranilate synthase component 1

491 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.748 kDa

MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYSFIGLPCSHYLKAGGKHVDVYQNGEIVEQYDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLVGYFGYETVYNFEHFAHRLKNTAKANPLGTPDILLMLSQELAVIDNLSGKIHLIVYADPSQPDSYERARERLEDIRTQLRQSCAIPLSLGSKQTQAVSEFGEEPFKACVDKIKDYIFAGDCMQVVPSQRMSMEFTDNPLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERDDVIVRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKMVIEKYSHVMHIVSNVEGCLKEGVTNMDILAATFPAGTLSGAPKVRAMEIIEEIEPEKRGIYGGAVGVWGFNNDMDLAIAIRTAVIKNNTLFIQSGAGVVADSDPTSEWQETQNKARAVVRAAQMVQEGLDK

trpE

Anthranilate synthase component 1

491 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.748 kDa

MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYSFIGLPCSHYLKAGGKHVDVYQNGEIVEQYDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLVGYFGYETVYNFEHFAHRLKNTAKANPLGTPDILLMLSQELAVIDNLSGKIHLIVYADPSQPDSYERARERLEDIRTQLRQSCAIPLSLGSKQTQAVSEFGEEPFKACVDKIKDYIFAGDCMQVVPSQRMSMEFTDNPLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERDDVIVRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKMVIEKYSHVMHIVSNVEGCLKEGVTNMDILAATFPAGTLSGAPKVRAMEIIEEIEPEKRGIYGGAVGVWGFNNDMDLAIAIRTAVIKNNTLFIQSGAGVVADSDPTSEWQETQNKARAVVRAAQMVQEGLDK

trpE

Anthranilate synthase component 1

491 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.722 kDa

MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYSFIGLPCSHYLKASGKHVDVYQNGEIVEQHDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLVGYFGYETIYNFEHFAHRLKNTTKADPLGTPDILLMLSQELAVIDNLSGKIHLVVYADPSQPDGYERARERLEDIRTQLRQSCAIPLSLGSKHTEAVSEFGEEPFKACVNKIKDYIFAGDCMQVVPSQRMSMEFTDSPLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERDDVIVRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKMVIEKYSHVMHIVSNVEGRLKDGMTNMDILAATFPAGTLSGAPKVRAMEIIEEVEPSKRGIYGGAVGVWGFNNDMDLAIAIRTAVVKNNTLYVQSGAGVVADSDPASEWQETQNKARAVIRAAQMVQEGLDK

trpE

Anthranilate synthase component 1

491 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.702 kDa

MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYSFIGLPCSHYLKASGKHVDVYQNGEIVEQHDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLVGYFGYETIYNFEHFAHRLKNTTKADPLGTPDILLMLSQELAVIDNLSGKIHLVVYADPSQPDGYERARERLEDIRTQLRQSCAIPLSLGSKHTEAVSEFGEEPFKACVNKIKDYIFAGDCMQVVPSQRMSMEFTDSPLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERNDVIVRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKMVIEKYSHVMHIVSNVEGRLKDGMTNMDILAATFPAGTLSGAPKVRAMEIIEEVEPSKRGIYGGAVGVWGFNNDMDLAIAIRTAVVKNNTLYVQSGAGVVADSDPASEWQETQNKARAVIHAAQMVQEGLDK

trpE

Anthranilate synthase component 1

482 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

53.699 kDa

MFLFVETIRPQQRGESLLETVIKVVPGERFTPYGLALKLGARVVLESSSSKKGRDRYSLLLLQEAFRVAQEGTEVYFVKDGRRSKVKANHRDILDVLMYFARQHSDPGQDFPFPAGGVGYLSFEFCRYCDTIHLNPAKPDPLELPDALFLFGHVFLIYDHYTDLIYLVGLNYKEASIDLEAALAAVEARVNDGDWSALGSVGAPYDAEVLPQDYDPDETYKANVGAMRQEVIAGNLLQGVPSRRLLVKTEMPAIEAYRRLRSSNPSPYMFYLDFGDYQLFRASPELHVKVKGGTAEIRPIAGTRRRGATDAEDRALEAELLADVKERAEHLMLVDLARNDLGRICQPGTVQVKDSYFIERYSHVMHIVSSVEGRLKDDKTGIDALRASFPAGTVSGAPKIRAIEVIDRLEPVQRRFYSGVVGHLSPDGSLDTCIAIRSALKKGDTMVLQAGGGIVFDSNPDRELEETYEKMRATARSLGLEI

trpE

Anthranilate synthase component 1

474 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

54.3 kDa

MIIKKIKMDVCPLDVYEQIRGENTFLLESAEGVPKVARYSILGKAEGKVIFKNGKLKVESFTEFGDKAKDLEGKYECPLDALREVRNEYLKYIDISNIEPIPRFKGGLVGYLSYDIIRYWIDLSNINPKPINDLKFPDAEFFIVKDFISFDLKEKVINLIAEDDEGIRELERIIKNAKIGNNDNKEEKTTENKDLKIKSNMSKEEFIEAVKKAKEYIFAGDIFQVVLSRRIEIDLDNLDHLKIYKKVREINPSPYMYYLDFGDRKIIGSSPEILVRTDYKDNKRLVITRPIAGTIRRGKTEEEDKELEKKLLSDEKERAEHVMLVDLARNDIGKISKFGTVEVTDFMIIEKYSHVQHIVSNVVGELKDNYDSFLAVKATFPAGTLSGAPKVRAMEIIEELEKTWRGPYGGGVGYFGWDDLMDLAITIRTFVISKNKGYIQVGAGIVADSIPENEWEETERKGMANVKTIESLLK

trpE

Anthranilate synthase component 1

464 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

52.321 kDa

MNVFGITELKNPVKEKIEFKEPFELFKSIYSEYDSSFLLESMESDTGLARYSFMGFEPQMIIRARSGFIEVEYEGSREEFDTENPFEFLRQFTRPAGKSRGFCGGLVGYISYQAARFFDSINLSPGNFPDFEFGLFLDGIMFNHLTGECSYISLKENRLPEISELLREETPTGHLKYRSMGTLFSRRRYLGMVEEARERIAEGEIFQAVLSNATDYRLRGDRLALYEALRRVNPSPYMYHLKLGSREITGSSPEMLVRVEDKQIETFPIAGTRPRGKTPHEDERIAAELLSDEKELAEHLMLVDLARNDLGRISEFGTVQVPEYMTIRRFSHVQHILSHVTGRLRKGMDALDALGAVFPAGTVSGAPKIRAMEIIESLEGVPRNAYAGALGYLSLNGNADFAITIRSMVAEGAYGRIQAGAGIVHDSVPEREYVECQNKAMAVLKSMELAGDGFDSDEPFIARR

trpE

Anthranilate synthase component 1

462 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

51.635 kDa

MERIRPYRKTFLADLETPVTAYLKLAEKAPVSFLLESVERGRQSRFSIVGVGARRTFRLKDGVFTVNGERVETRDPLRALYERVYAPLERHPDLPPFFGGVVGYAAYDLVRYYERLPSLKPDDLGLPDLLFVEPEVVAVFDHLKNLLHLVAPGRDPEEAEARLFWAERRLKGPLPGVPGERAGGRARFQADFSREAYLEAVRRALDYIRAGDIFQVVLSLRLSSPLTVHPFALYRALRSVNPSPYMGYLDLGEVVLVSASPESLLRSDGRRVVTRPIAGTRPRGKDEEEDKRLAEELLRDEKEVAEHVMLLDLSRNDIGRVAAFGTVRVLEPLHVEHYSHVMHLVSTVEGILAEGKTPLDALASVLPMGTVSGAPKIRAMEIIEELEPHRRGPYGGSFGYLAYDGAMDMALTLRTFVVAKGWMHVQAGAGIVADSVPEREYEECWNKARALLKAVEMAEAGL

trpE

Anthranilate synthase component 1

462 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

51.834 kDa

MSQTLPKIKIPKKPNYNSLALAEGIEFWELFRVIEAKYENCFLLESAGDNQYDSRYSVIGFQPSHLILGEPGILEIDGKKYPVENPYFALRELTDYNSLSISYAGGFVGYLGYQSMQFFEPKLQLKPHPDFPAMIFGLYLDGLIYDKFTGELIYFDNGTNRIHEVNQILEQLKKENSQKPKATVSLVKAGLSKEVHKQMVEEALEEVKAGNTFQCQIGFEEIYQVDGNPLAIYETLREINPSPHMYYVNLELVTILGASPSSLFRLRQGEMESFPLAGTTKRGVDAKEDTLLARKLLTDPKEIAEHNMLIDLHRNDVGRVAKFGTVKVRRRFDVKRFSHVQHISSEVVGILSSKEDMFSGLASSFPRGTLSGAPKIESDSKIIERIEKSPRGPYGGAVGSFGLNGDCTFAIPIRSFFVNGKKGFVRASGGIVFGFIEPEDEYQEIINKMASVRKALDLHKGP

trpE

Anthranilate synthase component 1

461 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

52.24 kDa

MGDSMHVLKLVSDLETPVSTFMKVSRGEEFAFLLESVELGSAFGRHSFIGIGKKDVLVFEKGILRTSNQQLDYTSSPLKAIKDWLEVYRYSVKHDELPSFRGGAVGFVSYDYISYIEKVKVKASVFPTFYFVVPEHLIIFDHLKNNVFIISDSPEELTSKVLSPFEEKPEKNVFVTEPESNFEREQFYKVVEKAKKYIVEGDIFQVVLSQAFTFKTTLDPFYIYRALRMINPSPYMFYLKFGDTVVLGSSPETMAKVEGDKATVKPIAGTRPRGRTVEEDLKLERELLNDEKEIAEHVMLVDLGRNDLGRVCKEGTVRVEKKMVIERYSHVMHIVSQVSGELKDDKDAVDVFEATFPAGTVSGAPKVRAMEIIEELEPTPRGPYAGAVGYFSFPDDKGRMNMDSAITIRSFFFKGKQGWLQAGAGIVYDSVPEREYQETLNKLRALFRSLEVAQKIQGGLF

trpE

Anthranilate synthase component 1

461 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

51.911 kDa

MGVNVFGIINLEKPRKEKLEFREPFEVFKSIYSEYESSFLLESMESDTGLARYSFIGFEPEMIIRAREGVIEIDDGDSREEFDSKNPFEDLRGFLKMEKNSGGFCGGLVGYISYQAARFFDTIRLSEGDFPDFEFGLFLDGIMFNHLTGECSYISRHGNRLPDISPLLGDEVPTGTLGYRRERTLLSKRRYMDMVLEAKERIREGEIFQAVLSSATDYRLRGDRLAFYESLRRINPSPYMYHLKLGEREITGSSPEMLVRVEDRRIETFPIAGTRPRGRTEEEDGVIASDLLSDEKELAEHLMLVDLARNDIGRVSEFGSVEVPEYMTIKRFSHVQHILSHVTGKLRDGMDAVDALGAVFPAGTVSGAPKIRAMEIIESLEGVPRNAYAGALGYLSLNGNADFAITIRSMVCQGKTGRIQAGAGIVHDSIPEMEYLECQNKARALLKSMEMAGEQVDPDNR

trpE

Anthranilate synthase component 1

456 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

51.676 kDa

MRKIKEISADTMTPISVYLRLKGKNKVILESIPRENDQSRFSIIALNPVKHIKFTDGILSVNDEIISDENPMEFLEKLVCQPESTDENLDLPFTSGAIGYAGFDTYGIFEGIQPELKDSIGTPDMYFMLYESALIFDHKREKLIFIEDNTYSQRSEKELQNALSANIESLSLLTEAENELTELSKLNFVSNMSQELFEEKVAKAKELIRNGDMFQVVLSQRLTADFTDNPFNYYRKLRVENPSSYMYFMEFDNFHVIGSSPERLVAVHGNQVSTNPIAGTRKRGQTEFEDQALIEDLESDPKEVAEHKMLVDLGRNDIGKISKYGSIEVPVFMKVEKYRYVMHITSEVTGELRPEFTAMDALRATLPAGTLSGAPKHRAYQRIYEFETQKRGIYGGAIGYLTKNGNCDFAIAIRTMVLKDKKAHVQAGAGIVYDSVPEHEYQETLNKAQGLLKVGQ

trpE

Anthranilate synthase component 1

438 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

48.31 kDa

MPSPPEPPLHWRDCRLEPILGFPRPRELAKSLEVQGEEWIALLESGGGLQHRSRYSFLAWGRRKSSETDAIRAYEELERLADDKCRALPCRSPTFFLVSYEAVVGEEPWLSRLVGRHEWPGMTAFSPEYVVVYDHAGGRVSVCPGDTPLPAPASRKESFSAEGPTYETSRKGFEAMVADALERIRAGEAFQVVLSRVERYRVWGSLFSAYERLADANPSPYLYYARLGGRVIIGSSPELLVKLEAGRVETHPIAGTRPRGSTPIEDIELEVELLNDEKERAEHVMLVDLARNDITRVSIPGTVQVTSFMDIERYETVMHIVSRVEGVTRPSTTFVEALKALHPAGTVSGAPKPRAMEIIAELEEEARGPYAGAIGVAGSSAGEAAIVLRSAWLLDDGETLEARAGAGIVYDSKPEREYMETVQKLGSLKRALGVDMCG

trpE

Anthranilate synthase component 1

433 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

48.541 kDa

MPLKKLKPVDPLKLYSALRDFGMPFMLRSAEKDSRKARFTYISAEPEFVVEVGEGTEIDGERVSDERNPLRALKGLMGERVEGRRFMGGFVGYVSYDSVHSIIGGKIEEPSVFGYYPWTFIYDHSTGALSFFYLREAPFDPEALVERARREESRLEDGGSEVISTDAGMEEFVEIVRAGKEYIYSGDVFQVVLSREYRVRTDLDALEIYKRLVELNPSPYTFILEFEKTVVGASPETMGSVEGRTFKINPIAGTAPRGRTGEEDRELEKALLSDEKERAEHVMLVDLARNDVRRVSKPGSVRLTRFFDVLKYSHVQHIESEVVGELDEGKNAFDAMEAAFPAGTLTGAPKIRAMEIIDELERSRRKVYGGAVGYFSLTGDADMAIAIRMAEIEGRKASVRAGAGIVADSVPEKEFFETENKMRAVLKALGVRE

trpE

Anthranilate synthase component 1

421 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia.

Belongs to the anthranilate synthase component I family.

47.652 kDa

MEVHPISEFASPFEVFKCIERDFKVAGLLESIGGPQYKARYSVIAWSTNGYLKIHDDPVNILNGYLKDLKLADIPGLFKGGMIGYISYDAVRFWEKIRDLKPAAEDWPYAEFFTPDNIIIYDHNEGKVYVNADLSSVGGCGDIGEFKVSFYDESLNKNSYERIVSESLEYIRSGYIFQVVLSRFYRYIFSGDPLRIYYNLRRINPSPYMFYLKFDEKYLIGSSPELLFRVQDNIVETYPIAGTRPRGADQEEDLKLELELMNSEKDKAEHLMLVDLARNDLGKVCVPGTVKVPELMYVEKYSHVQHIVSKVIGTLKKKYNALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGAVGFISADGNAEFAIAIRTAFLNKELLRIHAGAGIVYDSNPESEYFETEHKLKALKTAIGVR

trpE

Anthranilate synthase component 1

411 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

46.346 kDa

MQKHEYVNPVKLYSAIRDEKFPFILESAEKSGRARYTYISFNPLYTVRVGSRTRVDGEVISKISDPFDALNEIHVKGLLVGYVAYEAVKNYIGKKPQTPSVFGCYDGYFVYDHYLRKLFSVNVENADKIVERAKRVEVEQVRGNSEVLRAGSREKFEKMVERGKEQIFEGEVYQIVLSREYVVDTDLSPFQMYLNLRETNPSPYMFLLEFDRALIGSSPETMGRVEGNSFIINPIAGTARREAGREKEIAEKLLSDEKERAEHVMLVDLARNDVRKVCRAGSVRVSRFMEVVEYPSVLHIESEVVGELKAGVTHFDAMKATFPAGTVTGAPKLRAIELIDEIEGDCRGVYAGAVGYFSENVSDLAIAIRMIEFDGKARIRAGAGIVADSVPEREFFETENKIARVLRAVGL

trpE

Anthranilate synthase component 1

150 amino acids

Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Belongs to the anthranilate synthase component I family.

16.187 kDa

single

MQTQKPTLELVACDAAYRENPTALFHQVCGARPATLLLESADIDSKDDLKSLLLVDSALRITAIGDTVTIQALSANGASLLPLLDAALPAGVENKQQPNGRHLRFPAVSPLLDEDVRLRSLSAPDAFRPLQELVNVPAQEREVMFLGGMF