TRM112

Multifunctional methyltransferase subunit TRM112

135 amino acids

Acts as an activator of both rRNA/tRNA and protein methyltransferases. Together with methyltransferase MTQ2, required for the methylation of eRF1 on 'Gln-182'. Together with methyltransferase TRM11, required for the formation of 2-methylguanosine at position 10 (m2G10) in tRNA. Together with methyltransferase BUD23, required for the formation of 7-methylguanine at position 1575 (m7G1575) in 18S rRNA. Involved in biogenesis of both 40S and 60S ribosomal subunits.

Belongs to the TRM112 family.

15.066 kDa

MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV

trm112

Multifunctional methyltransferase subunit trm112

126 amino acids

Acts as an activator of both rRNA/tRNA and protein methyltransferases. Together with methyltransferase mtq2, required for the methylation of eRF1 on 'Gln-182'. Together with methyltransferase trm11, required for the formation of 2-methylguanosine at position 10 (m2G10) in tRNA. Together with methyltransferase bud23, required for the formation of a 7-methylguanine in 18S rRNA. Involved in biogenesis of both 40S and 60S ribosomal subunits (By similarity).

Belongs to the TRM112 family.

14.075 kDa

MKLLTANFLNCSNKKCTSSPEAFPLDVVDAKLAIQQLELKPEFLIGIMPRIDWNALLKTTRQLGNYSLPDEKPDLVDDSDEVLLKSLHNVLLETEITEGKMVCGNCGHVYPIFEGIPNMLLSESEI