About Products Protein Database Contact

tmem56-a

Gene
tmem56-a
Protein
Transmembrane protein 56-A
Organism
Xenopus laevis
Length
258 amino acids
Similarity
Belongs to the TMEM56 family.
Mass
29.555 kDa
Sequence
MDDVLISYCVVTGSFLGFQLLFSAISPRLFTKYSSTYRQLSFGKQCEWDSRFVSTNHALIVGSACLYILAYDDAVNADPIWGDPFWVKMNVAITCGYLVQDLLLLARFWKVMRDPYMVCHHLAVFYSYGYVLNRGVLPYFANFRLISELSTPFVNQRWFFDVIGKPRSSWPVLLNGLAMALVFFIVRIAVIPSYYSQVFATFGTEGYIRLGIGPQVAWIVSCVVLDILNVFWMYKIARGFYKVVKAKPDGKPRRNHAD