timmdc1

Complex I assembly factor TIMMDC1, mitochondrial

292 amino acids

Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I (By similarity).

Belongs to the Tim17/Tim22/Tim23 family.

32.372 kDa

MCTAVRQDLSLKCGGTDVKQPGDSQPGHLRALLGFTLPSVYASDSSTQILPKHIGKPEFPDTGWDRIKDLFYNVEGQYTEELRNVVKSGIASAIVGMIYGGLPGARHARQRFIQCSQAEIYRNRVDAVRAAHNAAIRGFLRFGWRWSWRVAAFVTLFNTVNTGLTVYRDQNALSHFAVSGAVTGGVFRLNLGLRGLLSGTIIGVILGFPAGVLILGLQNLGGETMRDKRRRERRELHELRVTEWNARLKVTDDLIGEMSSLKHQDSEIDLQQVEELLSQPRNGNAAKGPYNQ

TIMMDC1

Complex I assembly factor TIMMDC1, mitochondrial

285 amino acids

Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I.

Belongs to the Tim17/Tim22/Tim23 family.

32.178 kDa

MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD

Timmdc1

Complex I assembly factor TIMMDC1, mitochondrial

285 amino acids

Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I (By similarity).

Belongs to the Tim17/Tim22/Tim23 family.

31.791 kDa

MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQLFAKDEQQRFSKEIDYIYRAAVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFRINLGVRGLVAGSIIGALLGAPMGSLLMALEKYSGETVQERRQKEWKALHEQRLEEWRSSLQVTELLPMEIESGLEKIQPEGDAQRIEELLSLPRNPSSPHQQSKH

Timmdc1

Complex I assembly factor TIMMDC1, mitochondrial

285 amino acids

Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I (By similarity).

Belongs to the Tim17/Tim22/Tim23 family.

32.05 kDa

MEAPPPAPRSRLCGAWGPFPRVFAAGAVAADSQSFVEDPELRSYVSDPGSSESGWDRLRQLFVKDEQRKISKEMDYICRAALSAGIIGWAYGGIPAFIYAKRRYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDALSHFAIAGAVTGGLFRINLGLRGLVAGGIIGALLGTPMGSLLMALEKHCGETVQERRQKDREAQQEQRLEEWRRNLQVTELLPMEIESGLEKIQPEKDAQRIEELLRLPRNPASPDKQSED

timmdc1

Complex I assembly factor TIMMDC1, mitochondrial

256 amino acids

Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I (By similarity).

Belongs to the Tim17/Tim22/Tim23 family.

28.246 kDa

MAQSDPPKSPDPPLPTSIRNPQTPESGWDRIRELFQPNEQGHYPEEVGSIVKSAVTGALLGGIYGGLPAARHSKERYIQQSQAQIYQHRVEAVRSAHNAALRGFIRYGWRWGWRVAAFVTIFNSVSTGLTVYRDKLALSHYAAAGAVTGGLFRLNLGLVGLLSGSLIGAALGVPAGALISGLQSISGESIREKKRRERQELYENKVQEWSARLQVTDEVLEEMETSQQDPLEQQVEKIQELLQLPRNPAVSPKEGR