Protein
Mitochondrial import inner membrane translocase subunit Tim13-B
Function
Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of some proteins while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins (By similarity).
Similarity
Belongs to the small Tim family.
Sequence
MDGFGSDFSVGGSSSGKVDTGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCVAMCMDRYMDAWNIVSRAYNSRLQRERAKM