tifA

Eukaryotic initiation factor 4A

405 amino acids

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon (By similarity).

Belongs to the DEAD box helicase family. eIF4A subfamily.

45.679 kDa

MSHKDRRGNSSNDGSSFKLNETFTSSEVEVKPTFESMGLREELLRGIFNYGFEKPSAIQQRAILPIIKGRDTIAQAQSGTGKTATFSIGALQCVEVNVRSPQVLILSPTRELAQQIQKVALALSEFMNIQVHACVGGKNLSDDVKKLETGVHIVSGTPGRVLDMITRKSLPTRHIKMMILDEADEMLSLGFQQQINDVYRYLPNGTQIVLVSATLTQDVVSMTEKFMTKPVRILLKRDELTLDGIKQFFVSVEKEDWKFGTLCDIYDSLTITQAVIFCNTKKKVDQLTEQMRDANFTVASMHGDMVQKEREEIIKSFRSGENRVLITTDILARGIDVQQVSLVINYDLPIDRENYIHRIGRSGRFGRKGVAINFVKNSDIRILRDIEQFYSTQIDEMPVNFASII

TIFA

TRAF-interacting protein with FHA domain-containing protein A

185 amino acids

Adapter molecule that plays a key role in the activation of proinflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs). Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism. TIFA-dependent innate immune response is triggered by ADP-D-glycero-beta-D-manno-heptose (ADP-Heptose), a potent PAMP present in all Gram-negative and some Gram-positive bacteria: ADP-Heptose is recognized by ALPK1, which phosphorylates TIFA at Thr-9, leading to TIFA homooligomerization and subsequent activation of proinflammatory NF-kappa-B signaling.

Belongs to the TIFA family.

21.579 kDa

MSSFEDADTEEMVTCLQMTLYHPGHQRSGIFRSIKFFNREKLPTSEVVKFGRNSHTCNYIFQDKQVSRVQFSLQVFKKFNSSVVSFEIKNMSKKTSLLVDNKELGYLNKMDLPDKCMIRFGDYQFLVEKEDGESLEFFEIQFSLSKKPLLQENNWLSQEPIPECGSYSSCLTQNNSPMEVGENEW

Tifa

TRAF-interacting protein with FHA domain-containing protein A

185 amino acids

Adapter molecule that plays a key role in the activation of proinflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs). Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism. TIFA-dependent innate immune response is triggered by ADP-D-glycero-beta-D-manno-heptose (ADP-Heptose), a potent PAMP present in all Gram-negative and some Gram-positive bacteria: ADP-Heptose is recognized by ALPK1, which phosphorylates TIFA at Thr-9, leading to TIFA homooligomerization and subsequent activation of proinflammatory NF-kappa-B signaling.

Belongs to the TIFA family.

21.548 kDa

MSTFEDADTEETVTCLQMTIYHPGQLQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTFQDKQVSRVQFALQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFILSPRPLLQENNWPTQSPIPEDGVYSSYFTHRSSPAEMDENEL

TIFA

TRAF-interacting protein with FHA domain-containing protein A

184 amino acids

Adapter molecule that plays a key role in the activation of proinflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs) (PubMed:12566447, PubMed:15492226, PubMed:26068852, PubMed:28877472, PubMed:28222186, PubMed:30111836). Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism (PubMed:15492226, PubMed:26068852). TIFA-dependent innate immune response is triggered by ADP-D-glycero-beta-D-manno-heptose (ADP-Heptose), a potent PAMP present in all Gram-negative and some Gram-positive bacteria: ADP-Heptose is recognized by ALPK1, which phosphorylates TIFA at Thr-9, leading to TIFA homooligomerization and subsequent activation of proinflammatory NF-kappa-B signaling (PubMed:30111836).

Belongs to the TIFA family.

21.445 kDa

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES

Tifa

TRAF-interacting protein with FHA domain-containing protein A

184 amino acids

Adapter molecule that plays a key role in the activation of proinflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs) (PubMed:11798190). Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism (By similarity). TIFA-dependent innate immune response is triggered by ADP-D-glycero-beta-D-manno-heptose (ADP-Heptose), a potent PAMP present in all Gram-negative and some Gram-positive bacteria: ADP-Heptose is recognized by ALPK1, which phosphorylates TIFA at Thr-9, leading to TIFA homooligomerization and subsequent activation of proinflammatory NF-kappa-B signaling (By similarity).

Belongs to the TIFA family.

21.56 kDa

MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMDENEL

tifa

TRAF-interacting protein with FHA domain-containing protein A

178 amino acids

Adapter molecule that plays a key role in the activation of proinflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs) (By similarity). Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism (PubMed:16023795).

Belongs to the TIFA family.

20.683 kDa

MDKELIDVDTEQTISCLTLTLYHPNHQDQKLFRGINFSRKEEIKADAVVAFGRDYNVCRYPLLSNRVSRIQFNLQLFKHFNCSTSTFEIKNLSKKNKLYVDNLELDYLNKIELPKKCMIRFGDFQILAEIDEGDSDEKFEICCEKSHVSLVQDSFIPTMQPIPECGTLNAVEIDENEC

tifa

TRAF-interacting protein with FHA domain-containing protein A

177 amino acids

Adapter molecule that plays a key role in the activation of proinflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs) (By similarity). Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism (By similarity).

Belongs to the TIFA family.

20.614 kDa

MDETLNVDTEQTLTCLTLTMYHPNHQDQKLFRGINFSRKEEIKADAVVAFGRDYNVCRYPLLSNRVSRIQFNLQFFKHFNCSTTAIEIKNLSKKNKLYVDNLELDYLNKIELPPKCMIRFGDFQILAVIERGDCDEKFEICCEKSHVSLVQDSFIPTMQPIPECGTLNAVEIDENEY