TFB1

General transcription and DNA repair factor IIH subunit TFB1

642 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB1 family.

72.894 kDa

MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEKRRREESAQHTETPMSSSSVTAGTPTPHLDTPQLNNGAPLINTAKLDDSLSKEKLLTNLKLQQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNVLSTIKPVASSENKVNVNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLRGEKIMQNDRGDVIIDRYLTLDQEFDRKDDDMLLHPVKKIIDLDGNIQDDPVVRGNRPDFTMQPGVDINGNSDGTVDILKGMNRLSEKMIMALKNEYSRTNLQNKSNITNDEEDEDNDERNELKIDDLNESYKTNYAIIHLKRNAHEKTTDNDAKSSADSIKNADLKVSNQQMLQQLSLVMDNLINKLDLNQVVPNNEVSNKINKRVITAIKINAKQAKHNNVNSALGSFVDNTSQANELEVKSTLPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDVLNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN

Tfb1

General transcription factor IIH subunit 1

585 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB1 family.

66.339 kDa

MTTSSEDVLLQMGEVRYKKGDGTLYVMNERVAWMAEHRDTVTVSHRYADIKTQKISPEGKPKVQLQVVLHDGNTSTFHFVNRQGQAAMLADRDKVKELLQQLLPNFKRKVDKDLEDKNRILVENPNLLQLYKDLVITKVLTSDEFWATHAKDHALKKMGRSQEIGVSGAFLADIKPQTDGCNGLKYNLTSDVIHCIFKTYPAVKRKHFENVPAKMSEAEFWTKFFQSHYFHRDRLTAGTKDIFTECGKIDDQALKAAVQQGAGDPLLDLKKFEDVPLEEGFGSVAGDRNVVNSGNIVHQNMIKRFNQHSIMVLKTCANVTSAPSTMTNGTNNANGPVSQSAYTNGMNGKGQATATATKSSSDQVDKDEPQSKKQRLMEKIHYVDLGDPILEGDDSANGEKAKSKHFELSKVERYLNGPVQNSMYDNHNDPMSLEEVQYKLVRNSESWLNRNVQRTFICSKAAVNALGELSPGGSMMRGFQEQSAGQLVPNDFQRELRHLYLSLSELLKHFWSCFPPTSEELETKLQRMHETLQRFKMAKLVPFENRAMHELSPLRSSLTQHLNQLLRTANSKFATWKERKLRNTR

tfb1

General transcription and DNA repair factor IIH subunit tfb1

533 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB1 family.

60.6 kDa

MGDRVEALAIFRKKQGVLSIDSRLKWTGEGKTTPSVDIAFDAISNLQTTPASNPKVMIRVFIVVKEGEDPTSLVFHFTGTPNARENCDMITNELRNAIQRQREGSQSKPQGANVDRVNSTNLEKDIDLQESLLTNNPDLLQTFKEAVMKGHLSNEQFWSTRLHLLRAHAVERSQQRGPYNVLSTIKPKTVDNQMKVSLTGQQIHDMFEQHPLLRKVYDKHVPPLAEGEFWSRFFLSKLCKKLRGDRITPMDPSDDIMDKYLKDNEEVTKVSDEPIASHLFDLEGNDQNANVIAELRPDITMRIDKEALPFMKNINQLSERLLEKSLGNSKRFNNENEETYLKESGFHDLEEEASDSKVVLKIKGQDQLLENNFVPSKNQVGLEPLPSLEALQHLYQEDSISLNHIEHDSDSLAEAAMQLTQSMREKHEFETHGTASNLPIDIKNEIVLCHTVTIEFLHQFWNALLNTTFPDKKAMAPLQNALLNSKKRVEAIASQAQEQNVDPKLVYELVSCTLTSIDTSISEYQRRMSYPPA

tfb1

Transcription initiation factor IIB 1

300 amino acids

Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).

Belongs to the TFIIB family.

33.857 kDa

MSGKRVCPVCGSTEFIYDPSRGEIVCKVCGYVIEENVVDEGPEWRAFDPGQREKRARVGAPESILLHDKGLSTDIGIDRSLTGLMREKMYRLRKWQSRLRVSDAAERNLAFALSELDRLASNLSLPKHVEEEAARLYREAVRKGLIRGRSIEAVIAACVYAACRLLKVPRTLDEIADVSRVDKKEIGRSFRFIARHLNLTPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILEEAYQRGLTSGKSPAGLVAAALYIASLMEGEKRTQREVAEVARVTEVTVRNRYKELVEKLNLKVPIA