tenA

Cytochrome P450 monooxygenase tenA

508 amino acids

Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of tellinin that could be linked to insect pathogenicity (PubMed:17216664, PubMed:18266306, PubMed:20575135). The polyketide-amino acid backbone is first assembled by the PKS-NRPS hybrid tenS (PubMed:17216664, PubMed:18266306, PubMed:20575135). Because tenS lacks a designated enoylreductase (ER) domain, the required activity is provided the enoyl reductase tenC (PubMed:18266306). Upon formation of the polyketide backbone on the thiotemplate, the triketide is transferred to the NRPS module and linked to tyrosine to produce the acyltetramic acid intermediate called pretenillin A (PubMed:18266306). The cytochrome P450 monooxygenase tenA catalyzse an oxidative ring expansion of pretenellin A to form the 2-pyridone core of tenellin, leading to pretenellin B (PubMed:19067514). The cytochrome P450 monooxygenase tenB is then required for the selective N-hydroxylation of the 2-pyridone nitrogen of pretenellin-B to yield tellinin (PubMed:19067514).

Belongs to the cytochrome P450 family.

58.45 kDa

MLPLLDSVSLPYLILSACLSVILLRRFLAHDKGGSKSIAQGCLPEPRLRQWDPIFGFGIVISQARALRGHRYLEWLRDLHASMPHTKTFSANYGGYRWIFSIEPEILKAVYATNLQNFGVEPIRQHPPGFQPFAHKGVSTSDGDDWSFSRTLIKPFFERSVYISTDRIKPFADKFMTLLPDDGETFDIQPLLQRWFLDITSEFIFGKSQDSMTHADRAEVTWAMADVLRGGRQRAQTHRILWAFNWDWWFEAVEKVHGFLNPYIRSTLKELEERQQRIKDGLPVDEERTDLLWSMATMLPDEEELRSQVCLIFVPNNDTTSMFIGHCLYFLARNSNAWKRLRDEVDAVGDAPITFEMLRNMKYLNGILNETHRLIPNNVTQVRAALSDVVLPLGGGPNGKAPLDVRKGDIVSVTKTVMYRDPEQWGPDANEYRPERWDGMRGGWHFLPYGGGPRRCPAQMMVQNESAYMLFRLAQKYSTIVARDPEPFRARMRIGPSSMHGVKIAFYK

tenA

Aminopyrimidine aminohydrolase

236 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). To a lesser extent, is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity is unlikely to be physiologically relevant. Therefore, is involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

27.417 kDa

MKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGRMASHAQGTYEAEMALHREFAELLEISEEERKAFKPSPTAYSYTSHMYRSVLSGNFAEILAALLPCYWLYYEVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWGMAYRKEGWSDSAIKEVEECGASRHNG

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEAIMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.859 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLLGNIQADALRHYLQADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIINTKFWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP) (By similarity). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.841 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLLGNIQADALRHYLQADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFESLMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.729 kDa

MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQAHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.9 kDa

MTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIPKMSSMEDVKFLVEQIEFMLEGEVEAHEVLADFINEPYEEIVKEKVWPPSGDHYIKHMYFNAFARENAAFTIAAMAPCPYVYAVIGKRAMEDPKLNKESVTSKWFQFYSTEMDELVDVFDQLMDRLTKHCSETEKKEIKENFLQSTIHERHFFNMAYINEKWEYGGNNNE

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.9 kDa

MTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIPKMSSMEDVKFLVEQIEFMLEGEVEAHEVLADFINEPYEEIVKEKVWPPSGDHYIKHMYFNAFARENAAFTIAAMAPCPYVYAVIGKRAMEDPKLNKESVTSKWFQFYSTEMDELVDVFDQLMDRLTKHCSETEKKEIKENFLQSTIHERHFFNMAYINEKWEYGGNNNE

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.676 kDa

MTFSTEIKEAAQPIIEEIYNDGFIQDLLKGDLDAQAVRQYLRADASYLKEFTNLYALLIPKAPSMKDVKFLVEQIEFMLDGEVEAHEILADYINEPYEEIVKEKVWPPSGDHYIKHMYYHAYAHENAAYTIAAMAPCPYVYEVVAKMALDDQNLNRDSVTSKWFDFYSTEMRPLIEVFDNLLDELTANCTEQEKKDIKESFLQSTIHERNFFNMAYINEQWNFGGDKNA

tenA

Aminopyrimidine aminohydrolase

229 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.881 kDa

MLFSEQLKKEAKPIINQIYHDPFIQGMLHGNLPTEATKFYLRADASYLNEFANIYALLIPKMGNLNDVRFLVEQIQFIVDGEVEAHEILADYVQESYNEIVQEKVWPPSGDHYIKHMYFNAYAKENAAYTIAAMAPCPYVYQFIAQEALRDKELNKDSILAKWFEFYSTEMDELVIVFDNLMDKLTKHCSEKEKNEIKQCFLQSTVHERNFFNMSFNEESWSYGGMKNE

tenA

Aminopyrimidine aminohydrolase

228 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). Is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity may not be physiologically relevant. Therefore, is probably involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

26.785 kDa

MNFAETLERDAQPIIDEIYQDHFIQELLKGDIKKEALRQYLRADASYLREFANIYALLIPIMPDLESVRFLVDQIQFIVNGEVEAHEYMADYIGENYNEIVQKKVWPPSGDHYIKHMYYNVYAHENAAYAIAAMAPCPYVYAMIAKRAMKDPNLNKSSILAKWFEFYNTEMDPLIEVLDDLMNQLTANMSETEKNEVRENYLQSTVHELNFFNMAYTSEKWQFGGERV

tenA

Aminopyrimidine aminohydrolase

224 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway. Thus, catalyzes the conversion of 4-amino-5-aminomethyl-2-methylpyrimidine to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP). To a lesser extent, is also able to catalyze the hydrolytic cleavage of thiamine; however, this thiaminase activity is unlikely to be physiologically relevant. Therefore, is involved in the regeneration of the thiamine pyrimidine from thiamine degraded products present in the environment, rather than in thiamine degradation.

Belongs to the TenA family.

25.585 kDa

MSFAASLYEKAQPIWEAGYNHPFVQGIGDGSLEKSKFQFFMKQDYLYLIDYARLFALGTLKGNDLQTMSTFSKLLHATLNVEMDLHRAYAKRLGISAEELEAIEPAATTLAYTSYMLNVAQRGSLLDLIAAVLPCTWSYYEIGVKLKGIPGASDHPFYGEWIKLYASDEFKELADWLIQMLDEEAKGLSSKEKAKLETIFLTTSRLENEFWDMAYNERMWNYNG

tenA

Aminopyrimidine aminohydrolase

217 amino acids

Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds to give a hydroxymethylpyrimidine (HMP). Displays low activity on 4-amino-5-aminomethyl-2-methylpyrimidine as substrate, indicating that the enzyme may act on a different HMP precursor that may derive from the human stomach food assumption or processing. Is probably involved in thiamine biosynthesis. Does not display thiaminase II activity, as it is unable to hydrolyze thiamine.

Belongs to the TenA family.

25.013 kDa

MQVSQYLYQNAQSIWGDCISHPFVQGIGRGTLERDKFRFYIIQDYLFLLEYAKVFALGVVKACDEAVMREFSNAIQDILNNEMSIHNHYIRELQITQKELQNACPTLANKSYTSYMLAEGFKGSIKEVAAAVLSCGWSYLVIAQNLSQIPNALEHAFYGHWIKGYSSKEFQACVNWNINLLDSLTLASSKQEIEKLKEIFITTSEYEYLFWDMAYQS