tdo-2

Tryptophan 2,3-dioxygenase

404 amino acids

Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety (By similarity). Involved in regulation of protein homeostasis, longevity and reproducive life span. Specifically regulates proteotoxicity due to age-related aggregation of proteins like alpha-synuclein, via its effects on tryptophan metabolism (By similarity).

Belongs to the tryptophan 2,3-dioxygenase family.

46.862 kDa

MACPYMNGGDTLPHRVTFMEGGEECQQGVNKVEMGFGQTYPEYLQLDKILTAQKLKSEADGQRVDDEHLFIVIHQAHELWFKQIIFDLDIVRKLLNNTIVDETKTLKIVSGLDRIVKILSLLTEQITLLDTMSPLDFVDFRKYLTPASGFQSLQFRILENKLGVKQERRIKYNAQHYKNVFNDDDLKALNTTEDEKSLLTLIESWLERTPGLKSTSEDEGFWSKYESSVNKYLSDLAKQAEDPSNTEEIKKQLRAEYSKTSDAFQSILDPRQHEQHIRNGNRLLSHDATKGAMMIYFYRDMPRFSQPYQILTFLMDIDSLFTKWRYNHVLLVQRMLGAKQGTGGSSGYMYLRSTVSDRYKVFLDLFNLSTWLIPREYIPMLSPRMVKTLSEHSNLSHSQSSESE

tdo-2

Tryptophan 2,3-dioxygenase

403 amino acids

Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine (PubMed:27995966). Catalyzes the oxidative cleavage of the indole moiety (PubMed:27995966). Involved in regulation of protein homeostasis, longevity and reproducive life span (PubMed:22927396, PubMed:27995966). Specifically regulates proteotoxicity due to age-related aggregation of proteins like alpha-synuclein, via its effects on tryptophan metabolism (PubMed:22927396).

Belongs to the tryptophan 2,3-dioxygenase family.

46.716 kDa

MACPYLGSGELTHRVTFMEGGEECQQGVNKVEMGFGQTYSEYLQLDKILTAQRLKSEADGQRVDDEHLFIVIHQAHELWFKQIIFDLDNVRKLLNNTIVDETKTLKIVSGLDRMTKILSLLTEQITLLDTMSPLDFVDFRKYLTPASGFQSLQFRVLENKLGVRQERRIKYNAQHYKNVFNDTDLKTLNVTEEEKSLLTLIESWLERTPGLKSTSEDEGFWIKYEKSVNKYLADLAKQAADPSNTEEIAKQLTAEYHKTADAFQSILDPRQHEQHIRNGNRLLSHDATKGAMMIYFYRDMPRFSQPYQILTFLMDIDSLFTKWRYNHVLLVQRMLGAKQGTGGSSGYMYLRSTVSDRYKVFLDLFNLSTWLIPREYIPMLSPRMVKTLSEHSNLSHSQSSESD