Function
Aminotransferase; part of the gene cluster that mediates the biosynthesis of terrequinone A, an antitumor agent (PubMed:17704773, PubMed:16426969, PubMed:17291795, PubMed:22083274). The first step in the biosynthetic pathway for terrequinone A is formation of indole pyruvic acid (IPA) from L-tryptophan by the aminotransferase tdiD (PubMed:17704773). TdiA then immediately converts unstable IDA to didemethylasterriquinone D (DDAQ D) (PubMed:17704773). TdiB then catalyzes reverse prenylation by transferring dimethylallyl diphosphate to carbon atom 2' of DDAQ D, to yield asterriquinone C-1 (PubMed:18029206). Finally, tdiC and tdiE enzymes robustly convert asterriquinone C-1 to terrequinone A via a transformation involving regular prenylation at carbon atom 5, which requires elimination of the hydroxy group on C-5 (PubMed:17704773, PubMed:18029206).
Sequence
MGSIGANNAVADPTPLFSSRVQKWEPGAIRSLLPLEALPGMISLVAGKPSPETFPIAEIAISLKDTPAGTGRIVVDGDELNQALQYGLPRGNAQLIQWFESLQRSVHGLDENGGWSCCIGNGSQELIHRVIQVFTDPGDPVLLETPAYPGVAGFLRADGQELIPVYSDAQGLNPASLEQALSEWPGDSPRPKVLYTTPTGSNPTGQSCTESRKAEILRLAKRFNFIILEDDAYYYLNYGDDKQRARSYLALERDVNGESGRVVRFDSLSKIVSPGMRLGILTAQAAVVDKVVRITENINLQPSSTTQLLALSLLRHWGQAGFLKHCAEAAEVYRRRRDVFVSAAERHLQGRATWVVPTAGMFVWLELKLPPEMDSFELLKSQGMKNGVLAIPGVAFMPGNEQTCYIRVSFSLVPERDMDEACRRIAGLVDRCACHS