tatAy

Sec-independent protein translocase protein TatAy

57 amino acids

Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. Required for YwbN secretion.

Belongs to the TatA/E family.

6.065 kDa

MPIGPGSLAVIAIVALIIFGPKKLPELGKAAGDTLREFKNATKGLTSDEEEKKKEDQ