tatAd

Sec-independent protein translocase protein TatAd

70 amino acids

Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. Required for PhoD secretion. The cytosolic fraction of TatAd binds the precursor of PhoD.

Belongs to the TatA/E family.

7.431 kDa

MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATKSLVSGDEKEEKSAELTAVKQDKNAG