sucD

Succinate-semialdehyde dehydrogenase (acetylating)

453 amino acids

Catalyzes the reduction of succinate semialdehyde to succinyl-CoA. The enzyme is specific for succinate semialdehyde and succinyl-CoA, and only shows low activity with palmitoyl-CoA. There is no activity with NAD(+) as cosubstrate.

48.968 kDa

MSNEVSIKELIEKAKVAQKKLEAYSQEQVDVLVKALGKVVYDNAEMFAKEAVEETEMGVYEDKVAKCHLKSGAIWNHIKDKKTVGIIKEEPERALVYVAKPKGVVAATTPITNPVVTPMCNAMAAIKGRNTIIVAPHPKAKKVSAHTVELMNAELKKLGAPENIIQIVEAPSREAAKELMESADVVIATGGAGRVKAAYSSGRPAYGVGPGNSQVIVDKGYDYNKAAQDIITGRKYDNGIICSSEQSVIAPAEDYDKVIAAFVENGAFYVEDEETVEKFRSTLFKDGKINSKIIGKSVQIIADLAGVKVPEGTKVIVLKGKGAGEKDVLCKEKMCPVLVALKYDTFEEAVEIAMANYMYEGAGHTAGIHSDNDENIRYAGTVLPISRLVVNQPATTAGGSFNNGFNPTTTLGCGSWGRNSISENLTYEHLINVSRIGYFNKEAKVPSYEEIWG

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

305 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

32.221 kDa

MAILVNKDTKVVVQGITGKEGSFHAKQCKEYGTQVVAGVTPGKGGMEVEGIPVFNTVKEAVKETGANCSLIFVPAPFAADAIVEALDAGIELVVCITEGIPVKDMMMVKDYMLKNYPNAKLVGPNCPGVITPGEAKVGIMPGHIFKRGKIGIVSRSGTLTYEAAYQLTKYGLGQSTAVGIGGDPVHGLTHRDVIEMFNKDPETEAILMIGEIGGTEEEEAAEYIEKEVDKPVFAYIAGITAPPGKRMGHAGAIIMGGKGTAKAKMEALEKAGAYVIENPAKIGETVAKILKVIELEEEERTSDAE

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

303 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.201 kDa

MTHMSIFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHEDKGGRLIKLPVFGSVAEAMEKTGADVSIIFVPPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYAWAYNLEAGHKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLVSKSGTLTYQMMFELRDLGFSTAIGIGGDPVIGTTHIDAIEAFEKDPDTKLIVMIGEIGGDAEERAADFIKTNVSKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREILLSL

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

303 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.229 kDa

MTHMSIFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHEDKGGRLIKLPVFGSVAEAMEKTGADVSIIFVPPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYAWAYNLEAGHKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLVSKSGTLTYQMMFELRDLGFSTAIGIGGDPVIGTTHIDAIEAFERDPDTKLIVMIGEIGGDAEERAADFIKTNVSKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREILLSL

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

303 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.229 kDa

MTHMSIFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHEDKGGRLIKLPVFGSVAEAMEKTGADVSIIFVPPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYAWAYNLEAGHKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLVSKSGTLTYQMMFELRDLGFSTAIGIGGDPVIGTTHIDAIEAFERDPDTKLIVMIGEIGGDAEERAADFIKTNVSKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREILLSL

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.542 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTVNK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.542 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTVNK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.542 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTVNK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.568 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYELLLTVNK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.526 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYEALLTVNK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.526 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYEALLTVNK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.685 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTQIVAGVTPGKGGQVVEGVPVYNTVEEAKNETGANVSVVYVPAPFAADSIIEAADADLDMVICITEHIPVVDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDSETKAVVMIGEIGGTAEEEAAQWIKENMNKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTASEKIKTLNDCGVETADTPSEIGTTLIDAAKKAGIYEELLTIKK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

302 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.699 kDa

MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTQIVAGVTPGKGGQVVEGVPVYNTVEEAKNETGANVSVVYVPAPFAADSIIEAADADLDMVICITEHIPVVDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDSETKAVVMIGEIGGTAEEEAAQWIKENMNKPVIGFIGGQTAPPGKRMGHAGAIISGGKGTASEKIKTLNDCGVETADTPSEIGTTLIDAAKKAGIYEELLTIKK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

300 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

31.382 kDa

MSVFINKDTRVIVQGITGSTALFHTKQMLEYGTNIVGGVTPGKGGTEAEGVPVFNTVAEAVQTTGANASVIYVPAPFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRFMEGKKTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTAVGIGGDPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANMTKPVVGFIGGKTAPPGKRMGHAGAIISGGKGTADEKIKTLNACGIEVAETPSVMGETLIKVLKEKNLFETCKTH

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

295 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit. Can also generate UTP or CTP, although it preferentially synthesizes ATP and/or GTP.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.266 kDa

MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVKEAVEATGAEASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDELGVRLIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTCVGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKANVTKPVVSYIAGVTAPPGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTGWEVKKA

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

294 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.667 kDa

MSILIDKETRVLCQGFTGKQGTFHSEQAIEYGTQMVGGVTPGKGGQSHLGLPIFNSVHEAVEETSADATMIFVPAPFCKDSIIEAVDAGVRLVVCITEGIPVLDMLEVKAYLRQHPDVRMIGPNCPGVITPGECKIGIMPGHIHQRGKVGIVSRSGTLTYEAVNQTTQMGFGQSTCVGIGGDPIPGTSFIDVLEMFEKDSQTQAIVMVGEIGGTAEEEAAEFIQSNVKKPVISYIAGVTAPPGKRMGHAGAIIAGGKGTAADKYAALEAAGVFVVKSPAEIGKGVAEATGWSTH

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

294 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.923 kDa

MVLRDKMILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQSAPEGKRMGHAGAIVEKGKGTAESKMKALEEAGAYVAKNISDIPKLLAGILGK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

293 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.389 kDa

MAILIDKNTKVICQGFTGGQGTFHSEQALAYGTQLVGGVSPNKGGTTHLGLPVFNTVREAVENTGVTATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNETGVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTCVGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDNVTKPVVAYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKSSKN

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

293 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.81 kDa

MRGSIMILLDEDTRCLVQGITGKQGSFHTRQMLEYGTRIVAGVTPGKGGQEFLGVDVYNSVEEVTEEMDVNASIIFVPAPFAKDAAFESIKHLDLVVIITEHIPVHDSMQIMEYASRMGKTVIGPNTPGIITPGIGKLGIMPTHIFTEGTIGIVSRSGTLTYEFAAQLTEAGFGQSTCVGIGGDPVTGLGFVDVLERFEDDPGTDAVVLIGEIGGDAEERAASYIEQMSKPVFAFISGATAPPGKRMGHAGAIIEGGTGTASSKREALEAAGAVVVDRPSAIVDEIRAQLGVR

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

292 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.297 kDa

MAILINKKTQVICQGFTGLQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGSKTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCIGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITRSPADIGKTMLDLLNKG

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

292 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.165 kDa

MAILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRALVGSKTRLIGPNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMFDLLNKG

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

292 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.176 kDa

MAILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLNLPVYNTVHEAKAKTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMIKVKRALIGSKTRLIGPNCPGVITPGECKIGIMPGHIHKIGDIGIVSRSGTLTYEAVAQTTAAGLGQSTCVGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGSAEEDAADFIKQSKIKKPIVSFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVIITRSPADIGKTMLDLLNKI

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

292 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.25 kDa

MAILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLNLPVYNTVHEAKAKTDANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRALIGSKTRLIGPNCPGVITPGECKIGIMPGHIHKTGIIGIVSRSGTLTYEAVAQTTAVGLGQSTCIGIGGDPVNGTSFVECIEMFLQDDETKAIIMIGEIGGNAEEDAADFIKQSKIKKPIVSFIAGITAPSDKRMGHAGAIISGGKGSAKDKLEALQSAGVTITKSPADIGKTMLDLLNKI

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

291 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

30.099 kDa

MAILVNKKTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGKTHLDLPIYNTVHEAKAKTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLDMVRVKRALVGSRTRLIGPNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFIKHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNG

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

289 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

29.777 kDa

MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

289 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.

Belongs to the succinate/malate CoA ligase alpha subunit family.

29.777 kDa

MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK

sucD

Succinate--CoA ligase [ADP-forming] subunit alpha

289 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit. Can use either ATP or GTP, but prefers ATP. It can also function in the other direction for anabolic purposes, and this may be particularly important for providing succinyl-CoA during anaerobic growth when the oxidative route from 2-oxoglutarate is severely repressed.

Belongs to the succinate/malate CoA ligase alpha subunit family.

29.777 kDa

MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK

sucD

Succinate--CoA ligase [GDP-forming] subunit alpha

288 amino acids

Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit (By similarity). Can use either ATP or GTP, but prefers GTP (PubMed:22751660).

Belongs to the succinate/malate CoA ligase alpha subunit family.

29.822 kDa

MILVNRETRVLVQGITGREGQFHTKQMLDYGTKIVAGVTPGKGGTEVLGVPVYDTVKEAVAHHEVDASIIFVPAPAAADAALEAAHAGIPLIVLITEGIPTLDMVRAVEEIKALGSRLIGGNCPGIISAEETKIGIMPGHVFKRGRVGIISRSGTLTYEAAAALSQAGLGTTTTVGIGGDPVIGTTFKDLLPLFNEDPETEAVVLIGEIGGSDEEEAAAWVKDHMKKPVVGFIGGRSAPKGKRMGHAGAIIMGNVGTPESKLRAFAEAGIPVADTIDEIVELVKKALG