Protein
Mitogen-activated protein kinase sty1
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Function
Mitogen-activated protein kinase involved in a signal transduction pathway that is activated by changes in the osmolarity of the extracellular environment. Controls osmotic regulation of transcription of target genes. Involved in osmoregulation and stress response pathways leading to an efficient start of sexual differentiation. Supports translation initiation and facilitates adaptation to environmental stress in part through reducing eIF2-alpha phosphorylation. Links the cell-cycle G2/M control with changes in the extracellular environment that affect cell physiology. Phosphorylates atf1 and mkp1. In conjunction with hal4, has a role in the cellular resistance to toxic cations such as Na(+), Li(+) and Ca(2+). Involved in resistance to arsenite, methylglyoxal and hydrogen peroxide. Involved in induction of thermotolerance in mRNA export, as well as in vacuolar fission.
Similarity
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily. HOG1 sub-subfamily.
Sequence
MAEFIRTQIFGTCFEITTRYSDLQPIGMGAFGLVCSAKDQLTGMNVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENIISLSDIFISPFEDIYFVTELLGTDLHRLLTSRPLETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFSIITELLGTPPMEVIETICSKNTLRFVQSLPQKEKVPFAEKFKNADPDAIDLLEKMLVFDPRKRISAADALAHNYLAPYHDPTDEPVADEVFDWSFQDNDLPVETWKVMMYSEVLSFHNMDNELQS