STAC3

SH3 and cysteine-rich domain-containing protein 3

364 amino acids

Required for normal excitation-contraction coupling in skeletal muscle and for normal muscle contraction in response to membrane depolarization. Required for normal Ca(2+) release from the sarcplasmic reticulum, which ultimately leads to muscle contraction. Probably functions via its effects on muscle calcium channels (PubMed:23736855, PubMed:29078335). Increases CACNA1S channel activity, in addition to its role in enhancing the expression of CACNA1S at the cell membrane. Has a redundant role in promoting the expression of the calcium channel CACNA1S at the cell membrane (By similarity). Slows down the inactivation rate of the calcium channel CACNA1C (PubMed:29078335).

41.507 kDa

MTEKEVLESPKPSFPAETRQSGLQRLKQLLRKGSTGTKEMELPPEPQANGEAVGAGGGPIYYIYEEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFETLRTGVIMANKERKKGQADKKNPVAAMMEEEPESARPEEGKPQDGNPEGDKKAEKKTPDDKHKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI

Stac3

SH3 and cysteine-rich domain-containing protein 3

360 amino acids

Required for normal excitation-contraction coupling in skeletal muscle and for normal muscle contraction in response to membrane depolarization (PubMed:23818578, PubMed:27621462, PubMed:29467163). Required for normal Ca(2+) release from the sarcplasmic reticulum, which ultimately leads to muscle contraction (PubMed:23818578). Probably functions via its effects on muscle calcium channels. Increases CACNA1S channel activity, in addition to its role in enhancing the expression of CACNA1S at the cell membrane (PubMed:27621462). Has a redundant role in promoting the expression of the calcium channel CACNA1S at the cell membrane (PubMed:25548159, PubMed:27621462, PubMed:29467163). Slows down the inactivation rate of the calcium channel CACNA1C (PubMed:25548159, PubMed:29363593).

41 kDa

MTEKEVVESPQPPFPGETPQSGLQRLKQLFKKGSPETAEMEPPPEPQANGEAVGAGGGPIYYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFRRAYSSPLYSDQQYAVSAANRNDPVFETLRVGVIMANKERKKGQADKKNPLAAMMEEEPESARPEEGKSQDGNNAEKDKKAEKKTPDDKNKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI

stac3

SH3 and cysteine-rich domain-containing protein 3

337 amino acids

Required for normal excitation-contraction coupling in skeletal muscle and for normal muscle contraction in response to membrane depolarization. Required for normal Ca(2+) release from the sarcplasmic reticulum, which ultimately leads to muscle contraction. Probably functions via its effects on muscle calcium channels. Increases CACNA1S channel activity, in addition to its role in enhancing the expression of CACNA1S at the cell membrane. Has a redundant role in promoting the expression of the calcium channel CACNA1S at the cell membrane.

38.765 kDa

MFKKKAKEEKPSPVPDAQQNGELPNSGPIIYYIYESEEEEEEEEEEPPPEPPRPVNDKPHKFKDHYLKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHHHCQSYVEFQKCFGKIPPGFRRAYSSPLYSNQQNACVKELMPFSASNRTDPVFDTLRVGVIMANKERKKGQDDKKNPMLEEEPEELPPKPEEKQEGDVPDGDKKGEKGGQDAKNKKAQPGFMQSHYFVALYRFKALEKDDLDFQAGERITVIDDSNEEWWRGKVGEKAGYFPANFIIRVRAAERVYKVTRSFVGNREIGQITLKKDQIVVQKGDEVNGYIKVSTGRKVGLFPLDFLQEI

stac3

SH3 and cysteine-rich domain-containing protein 3

334 amino acids

Required for normal excitation-contraction coupling in skeletal muscle and for normal muscle contraction in response to membrane depolarization (PubMed:23736855). Required for normal Ca(2+) release from the sarcplasmic reticulum, which ultimately leads to muscle contraction. Probably functions via its effects on muscle calcium channels. Increases CACNA1S channel activity, in addition to its role in enhancing the expression of CACNA1S at the cell membrane. Has a redundant role in promoting the expression of the calcium channel CACNA1S at the cell membrane (By similarity).

38.826 kDa

MAQYDQLEDKDSLDIHDNPPAPENVVKEDDNTVYFVYDEEVEEEEAPPPPTPEPIVQVNDKPHKFKDHYCKKPKFCDVCARMIVLNNKFALRCKNCKTNIHHSCQSYVQFQRCFGKIPPGFRRAYSSPLYDQEINNPGQQNRTDPVFDTLRVGVIMANKERKKGSEDKKNMMMMMMEEEEAQQPKEDEEGAEGKQDGDKKDKTATDDKNKKQQQTFSQSHYYMALYRFKAIEKDDLDFHPGDRITVLDDSNEEWWRGKIGEKTGYLPMTYIIRVRAGERVYKVTRSFVGNREMGQITLKKDQIVVKKGEEVNGYLKVSTGRKLGFFPADLLHEL