ssgB

Sporulation-specific cell division protein SsgB

165 amino acids

Involved in sporulation-specific cell division (PubMed:19567872). Required for early stages of sporulation. Important in the process of growth cessation prior to sporulation-specific cell division. Recruits cell division protein FtsZ to the future septum sites and tethers the contractile ring structure (Z ring) to the cytoplasmic membrane during sporulation. Stimulates polymerization and filament length of FtsZ in vitro (By similarity).

Belongs to the SsgA family.

17.971 kDa

MLVGNSWTRSLEPVSGHEHTEVDVPALPHRKTEVDVDVSLRLRTTSGPGLPVPASLHYGADDPYAIHAVFRGGDTDVEWVFARDLLREGLSAPAGAGDVQVQPCSDSPDGRPRVLLRLSSPDGNAELEADESDVRRFLRRADALVPPGRETRHLDLDELIARLVS

ssgB

Sporulation-specific cell division protein SsgB

143 amino acids

Involved in sporulation-specific cell division (PubMed:19567872). Required for early stages of sporulation. Important in the process of growth cessation prior to sporulation-specific cell division. Recruits cell division protein FtsZ to the future septum sites and tethers the contractile ring structure (Z ring) to the cytoplasmic membrane during sporulation. Stimulates polymerization and filament length of FtsZ in vitro (By similarity).

Belongs to the SsgA family.

15.282 kDa

MTIRHDSITAELALRLVVPGGAPVPVAATVRYEPADPYAISIGFRTGADEVVEWTFARQLLSDGVRRPAGDGDVQVWPAAQSGGRIVCLSLSSPSGHALFEMPRSEVLAFLRRTYSAVPLGGESDIIDLDAELALLIWGGPER

ssgB

Sporulation-specific cell division protein SsgB

143 amino acids

Involved in sporulation-specific cell division (PubMed:19567872). Required for early stages of sporulation. Important in the process of growth cessation prior to sporulation-specific cell division. Recruits cell division protein FtsZ to the future septum sites and tethers the contractile ring structure (Z ring) to the cytoplasmic membrane during sporulation. Stimulates polymerization and filament length of FtsZ in vitro (By similarity).

Belongs to the SsgA family.

15.561 kDa

MSVIRPTTVEVETSLRLVAPDATALPVRASLRYDPADPYAVHVLFHAESAGGEAVSWSFARELLVTGLDEPAGIGDVRVWPWATPRGDFVALALSSPDGNALFEVPRSVLVRFLRRTYVVVARGREAEHLDVDTAVNRLLAGR

ssgB

Sporulation-specific cell division protein SsgB

141 amino acids

Involved in sporulation-specific cell division (PubMed:19567872). Required for early stages of sporulation. Important in the process of growth cessation prior to sporulation-specific cell division. Recruits cell division protein FtsZ to the future septum sites and tethers the contractile ring structure (Z ring) to the cytoplasmic membrane during sporulation. Stimulates polymerization and filament length of FtsZ in vitro (By similarity).

Belongs to the SsgA family.

15.446 kDa

MRNDHVTLRSTAVFDLLAPQTPAVPVQVELRYDTRDPYAVVAAFRTGRAGWVEWVFARDLLADGLIAHAGVGDVTIRPAVDDPEVVVIELSSPSGHAVFEASAQELADFLDRTYDVVVPGNENLWVNVDDALTRLLPHDLS

ssgB

Sporulation-specific cell division protein SsgB

138 amino acids

Involved in sporulation-specific cell division (PubMed:19567872). Required for early stages of sporulation. Important in the process of growth cessation prior to sporulation-specific cell division. Recruits cell division protein FtsZ to the future septum sites and tethers the contractile ring structure (Z ring) to the cytoplasmic membrane during sporulation (By similarity). Stimulates polymerization and filament length of FtsZ in vitro (PubMed:21205868).

Belongs to the SsgA family.

15.251 kDa

MSSSGTSITCEVGLQLIVPDRAPVPLVARLDYSVDDPYAIRAAFHVGDDEPVEWIFARELLTVGIIRETGEGDVRIWPSQDGKERMVNIALSSPFGQARFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHLS

ssgB

Sporulation-specific cell division protein SsgB

137 amino acids

Involved in sporulation-specific cell division (PubMed:19567872). Required for early stages of sporulation. Important in the process of growth cessation prior to sporulation-specific cell division (PubMed:12900022). Recruits cell division protein FtsZ to the future septum sites and tethers the contractile ring structure (Z ring) to the cytoplasmic membrane during sporulation (PubMed:21205868). Stimulates polymerization and filament length of FtsZ in vitro (By similarity).

Belongs to the SsgA family.

14.865 kDa

MNTTVSCELHLRLVVSSESSLPVPAGLRYDTADPYAVHATFHTGAEETVEWVFARDLLAEGLHRPTGTGDVRVWPSRSHGQGVVCIALSSPEGEALLEAPARALESFLKRTDAAVPPGTEHRHFDLDQELSHILAES