srx-43

Serpentine receptor class X-43

319 amino acids

Receptor for the ascaroside pheromone icas#9 which suppresses exploratory forgaging behavior. In response to ascaroside icas#9, may furthermore play a role in the expression of genes in the TGF-beta signaling pathway, such as daf-7, and in insulin signaling pathway, such as daf-28, which may in turn contribute to exploratory behavior.

Belongs to the G-protein coupled receptor 1 family.

35.881 kDa

MVLRNLTAMAIYDQTFVYSSDDALAGMVVSMECLTGLFLLVAVIIGCFRIAALKSPFGILMINQNCAQLMACINSGSFSTLGVLLNIKPVLSISYLFGNFSIFLLPVILISFLLMSFNRFCACFFPLRYQNLFSSSMIRTFIVFNWLLSLVAGSYLVVVRECNFVFYHFGWLFAGSVSVKCGTLLSLYSISIQTVLSITIVGLDVVTLVALMAFRSKVYQSHSVEVRRRELSFSGQVIIQGAVFLCHGAWYDMGHAILPGNDDRWKFFFTTSFSSNLLHVFDPVVVFAFNKEFRRWLFRNFNVPTAQKRIVTVVSAHNT