Organism
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Function
Transpeptidase that anchors surface proteins to the cell wall. Recognizes both Leu-Ala-x-Thr-Gly and Leu-Pro-x-Thr-Gly, with a preference for the former. Unlike the S.aureus sortase it cleaves not only the Thr-Gly motif but also the Ala-X bond; Ala-Glu and Ala-His bonds are better substrates than the Thr-Gly motif in vitro (PubMed:22296345, PubMed:27936128). Among its possible substrates are the chaplins ChpA, ChpB and ChpC; this enzyme is less important for ChpC attachment than is SrtE2. A double knockout mutant of srtE1 and srtE2 shows a developmental defect in aerial hyphae formation more dramatic than that due to chaplin deletion (PubMed:22296345).
Similarity
Belongs to the bacterial sortase family. Class E subfamily.
Sequence
MTALRPERDSGTAGDQGSSYGQPYGDSGAFGGGRYEESAAGEENRPPLLDDETVALRIPEPPAPRTAAGTGPIGGGPDGGGRAARRKAAKRRHGRRGAPRDQAPEEEAEQAPKAPLSRVEARRQARARKPGAAVVASRAIGEIFITTGVLMLLFVTYQLWWTNVRAHAQANQAASNLQDDWANGKRSPGSFEPGQGFALLHIPKLDVVVPIAEGISSKKVLDRGMVGHYAEDGLKTAMPDAKAGNFGLAGHRNTHGEPFRYINKLEPGDPIVVETQDKYFVYKMASILPVTSPSNVSVLDPVPKQSGFKGPGRYITLTTCTPEFTSKYRMIVWGKMVEERPRSKGKPDALVS