srp19

Signal recognition particle 19 kDa protein homolog

178 amino acids

Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP (By similarity).

Belongs to the SRP19 family.

19.622 kDa

MTSAQPKAVDVSTIPGFKKWYIVYPNHINSELTKEKGRKVSKEHGVKNPTLPEIAEATAQLGLPCIIETSKGYPKEFFLRGRLRINFFCDGTTMPRNPHIPNKTVLLVKIAERIKLINPNRPEPFNPISMLAPIQAVSQKEKKPAPQPTTTTTTTTTPSSSSSSSSKGGKKKKNVNVI

Srp19

Signal recognition particle 19 kDa protein

160 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

18.395 kDa

MATAVPMKKNWSPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLMENKKYCRENSSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGSGGGGGGKKGKGKRR

SRP19

Signal recognition particle 19 kDa protein

145 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

16.274 kDa

MDSGTINIKKWVVIYPVYINSKKTVAEGRRISVSKSCENPNCIEISDCCKHLKLPSAVEIDKAYPRDFMQVGRVRVQLKREDGTLLNPAITSRKHLMQKIAELVPRHPERVKKQEAQKAKKQEPQATTSTSGTSSKSGKGGKKKR

SRP19

Signal recognition particle 19 kDa protein

144 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

16.14 kDa

MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCAAVGLNVFLEKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGGDQSLQQGEGSKKGKGKKKK

SRP19

Signal recognition particle 19 kDa protein

144 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

16.156 kDa

MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK

Srp19

Signal recognition particle 19 kDa protein

144 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

16.191 kDa

MACSAARPPADQDRFIFIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPILQQGEGSKKGKGKKKK

SRP19

Signal recognition particle 19 kDa protein

144 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

16.156 kDa

MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK

SRP19

Signal recognition particle 19 kDa protein

136 amino acids

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

14.922 kDa

MDGGDLRSSIKKWNVIYPVYLNSKKTVAEGRRIASGKACPDPTCVEIADCCSHLKIPHAIELDKAYPRDFFQVGRVRVQLKKDDGSPVNPAIKTKKQLMIQIAELVPKHHGRTKKQEPAASSTAGTSKGKGGKKKK

srp19

Signal recognition particle 19 kDa protein

112 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

12.769 kDa

MVFLREKEGPSGGSGRRIILWPAYFDSTLPRRLGRRVPRDMGVPSPKPEDVAEAARRAGFEAVVEESSYPRLWWRVRRRIVVLAPEDVSKTDIIKAVATELRKIAAARRKRS

srp19

Signal recognition particle 19 kDa protein

108 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

12.654 kDa

MKFVVWPSEIDSRLPRKYGRLVKKEVALEAPTPEEIRDAAEILGMKVIEFEPEKLNPRLSGIDEELRTKGMLRIESPYPKGKSLRMICEKIRELRAKKRKAHGKRKKR

srp19

Signal recognition particle 19 kDa protein

104 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

12.405 kDa

MKECVVWTVNLDSKKSRAEGRRIPRRFAVPNVKLHELVEACKELGLKFRAEEKKYPKSWWEEGGRVVVEKRGTKTKLMIELARKIAEIREQKREQKKDKKKKKK

srp19

Signal recognition particle 19 kDa protein

103 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

12.122 kDa

MSKEYRGRRIVLWPANIDSTLSRSEGRKIPLRDAVRKPRVEEIVEAANRLGLNPTVEEAAYPRSWWEQRKRVVVDKVGSKLNTLRMIAQEVKKLREERRRLGK

srp19

Signal recognition particle 19 kDa protein

103 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

12.277 kDa

MAETPTVKLKGKDRIVVWPAYFDADRSRSEGRKVPKRLAVRNPRLTELRHIAEKLGLNPKVQRDKRYPKRWWDDKGRLIVDKVESKRKTLLMIAEKLKERRES

srp19

Signal recognition particle 19 kDa protein

102 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

12.029 kDa

MSLRDLKEENRIVIWPSYFFSPTRSKGRRLARIPYKIKTEELVSTLRELGLDPIVIENKKYPRDRKINFLIAVKKVKSKNYTLKIIHNALMGTRQTNPNKSN

srp19

Signal recognition particle 19 kDa protein

101 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.94 kDa

MLKKNGFIVWPVYFDSTKPRKWRRVPRKLAVEKPTLSEIVEAVKREGFSFTVEENAKHPAYWYEVQGRVIVQANVKKSVLLKKIAENLQKIRAEQSSKRRR

srp19

Signal recognition particle 19 kDa protein

101 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.415 kDa

MKDKGKLVIWPAYIDQTRSRSNGRIISRKNAVKEPHLNEIKDAAKNLGLNPEVEPEKAYPKSWWEVSGRVLVDDRGPKSVIAKQISLEIRKKRGKGVPAKT

srp19

Signal recognition particle 19 kDa protein

101 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.375 kDa

MRDRGKLVIWPVYLDQTKSRSSGRIISRKNAIKEPQLNEIKEAARQLGLNPEVEPHKAYPKSWWEVSGRVLVDDNGPKTVIAKQIALAIKKMRGPESSAKA

srp19

Signal recognition particle 19 kDa protein

101 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.377 kDa

MKDKGKLVIWPAYIDQTKSRSSGRIISRKNSIKEPHLNEIKEAARQLGLNPEVEPEKAYPKSWWEVSGRVLVDDNGPKSVIAKQIALAIKKMRGQEVPAKT

srp19

Signal recognition particle 19 kDa protein

100 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.645 kDa

MGRFVVWPSELDSRLSRKYGRIVPRSIAVESPRVEEIVRAAEELKFKVIRVEEDKLNPRLSGIDEELRTFGMIVLESPYGKSKSLKLIAQKIREFRRRSA

srp19

Signal recognition particle 19 kDa protein

100 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.65 kDa

MGKKDYWVVWRINIDSTVSRSNGRVVPRQLAVDKPTLEEIAKAASMLGLKYEAHPEKKHPRHWFEEDYVGCIYVYKVDDYSRRSLIKKLAQIVKSSRRGG

srp19

Signal recognition particle 19 kDa protein

99 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.706 kDa

MGRFVVWPCELDSRLSRKYGRIIPKNLAIEKPSLDEIIEVAETLNLKIVEVDREKLNPRLSGIDEELRTYGRIIIESPYGKVKTLRLIAQKIREFRRRR

srp19

Signal recognition particle 19 kDa protein

99 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.626 kDa

MTLKKYKGKYVILWPQYFDSSLSRKEGRRVPRELAVARPSQKELLEVAAALGLEAKPLEGKYPREWWNKEGPVLVEKRGSKREVITLLAKELRRRRYGK

srp19

Signal recognition particle 19 kDa protein

99 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.541 kDa

MSKFVIWTSELDSRLSKKYGRVVPRNLAVERPSIEEIEEAAKSLGFKVLQVEREKLNPKLSGIDEDLRTYGRIIIESPYGKAKTLKIIAQKIRELRRRR

srp19

Signal recognition particle 19 kDa protein

97 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.237 kDa

MKKRGGRILWLVYLDSTIPKSRGRIIAKGVAVPKPTIQEVEEALRRLGYSYESYPEKKYPPLWFEERARGYFLVKSDEKPASIAAKVAEEIRRIRGQ

srp19

Signal recognition particle 19 kDa protein

97 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.902 kDa

MKEKHQIVIWPVYLDANKARNEGRLTPMSCSVKTPRVMEIFKAAEKLGLHPEHVTGKAHPAAWADKSGYVLVDNIGPKTDLLRRIGTEIIRMRGGKQ

srp19

Signal recognition particle 19 kDa protein

96 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.18 kDa

MKKRGGRTLWLVYIDLSVPRSRGRILPRSQAVNKPTLQEMVKALEALGYKYEVYPNKKYPPLWYDDRAQGYVVVKTDEKMRIIAAKVAEKIKQIRG

srp19

Signal recognition particle 19 kDa protein

95 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.305 kDa

MKKRGGRILWLVYLDSSVPRSRGRILPRSKAVSKPTLQEVIQALERLGYRYQVYQDKKYPALWFEERQGYIVVETSEKLRILALKVAEEVRKLRR

srp19

Signal recognition particle 19 kDa protein

95 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.113 kDa

MSRDYKGKKIVIYPQYIDSSIPRSRGRRIPRNIAIPKPRIEEIIEAAEELGLNPKYEESAYPKHWWIKGRIVVDKVGSKLNTLKLIAQKIKDLRK

srp19

Signal recognition particle 19 kDa protein

95 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.893 kDa

MSRDNKGRRIVVYPAYIDSKKSRSEGRKISLGKAVPNPSIKEIIEASERLGLNPLYEEKHYPRLKEGKGRVLVDKKSGKLEILRMIADEIRKMRG

srp19

Signal recognition particle 19 kDa protein

95 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.729 kDa

MREKGKLVIWPANLDKSRSRKGGRIISRKSSLEAPLLRELTAAAEKLNLNPEVEADKKYPRTWWESSGRILVDNNEAKTMVARKIAKTIKEARGG

srp19

Signal recognition particle 19 kDa protein

95 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

11.117 kDa

MKKKGGRILWLVYIDASVPRSRGRVLPRGLAVEKPSLKEVVQALEELGYKFQVFPDKKYPPLWFEEKWGYVVVETNEKIREIASKVAGKIREMRR

srp19

Signal recognition particle 19 kDa protein

93 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.341 kDa

MAVENIVWPRYLDASITRSDGRRVSLQDAIEDPEVDEIAEAVQQIGYDAVIEHDVAHPREWGTSGRVIVKGADDSSKNDLVQAVAAYIHLLRE

srp19

Signal recognition particle 19 kDa protein

93 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.737 kDa

MPEDRLVIWPAYFDLERSRGQGRRVATANAVRNPKLEDIIRASKDLGLDPVVETEKCYPKNWYEQPGRVLVLKKGSKTKTLRSIARALKKRRS

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.334 kDa

MVENVVYPAYFDADRSRSEGRRVPMDLAIEEPTVDEIAKAVQQVGYDAVIEREKTYSREFKPRGAVVVRGTEDTAKNDLVQAIAAYLGVIRE

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.179 kDa

MVENVIWPAALDANRSRSDGRRVSLDLAVENPTVDEIAKAVQQVGYDAVIERDKTYPREYEGRGRVVVKDADDATKSDLLGAVAAYMQALRE

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.213 kDa

MVENVIWPAYFDAALSRRDGRRVPMELAVEEPSIDEIATAVQQVGYDAVVERDVAYPRRHWDAAGRVLVKDADDAKNTLVQAVAAYVGALRD

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.213 kDa

MVENVIWPAYFDAALSRRDGRRVPMELAVEEPSIDEIATAVQQVGYDAVVERDVAYPRRHWDAAGRVLVKDADDAKNTLVQAVAAYVGALRD

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.159 kDa

MVENVIYPAYLDASLSRSEGRRVAQSAAVEAPTVDEIAKAVQQVGYDAVIERDKRYSREFETRGRVLVNNADDATKNDIVQAVAAYVGILRD

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.811 kDa

MKTIIWPTYINSEHSRGEGRKLSLEESVEEPKIREISQSLKKLKIQYVVEHNKSYPGSWWEKSGRVVVEQEDMTKLELLRAIAKNIKNSRNN

srp19

Signal recognition particle 19 kDa protein

92 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.2 kDa

MVENVIWPAYLDANCTRNEGRRVAEDLAVEEPTVDEIASAVQQVGYDAVIERSKTYPREYEPRGRVVVKGADDASKSDLLEAVAAYVTAIRE

srp19

Signal recognition particle 19 kDa protein

91 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.285 kDa

MEKGECILYPCYFNAALSRAEGRRVPRNIAAKGPNANDVERALRRLGIACQAEEHHHPAHWARHEGRIIATYTGKKEALIKKVARAIEVRK

srp19

Signal recognition particle 19 kDa protein

91 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.535 kDa

MNLIIWPTYLDSRKSRSEGRRVPLEYAVESPTASEILRAARKLQLEASMESDRAYPPSWWESSGRVVVEYNGKKSELLPKIARLVRSSRKR

srp19

Signal recognition particle 19 kDa protein

90 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.684 kDa

MKEIIIWSAYLDAEKSRKEGRKIPKELCVNNPKIKDIYNSLRKLGYNAEIVKNKCHPKEWWEIVGYIKVKVNDDIPKLEILKKICENLKK

srp19

Signal recognition particle 19 kDa protein

89 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.439 kDa

MKEMIIWPAYIDLKRTKNEGRKVPKEFAVQNPKLKDIAGKLKKMGLEYSIEHKKSYPKDPWEICGYIKVKADKRTSKLQILKEICKNMG

srp19

Signal recognition particle 19 kDa protein

89 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.482 kDa

MKEMIIWPTYIDSKRTKNEGRKVSKEFAVQSPKLKDIADKINKMGLEYSIENKKSYPREPWEICGYIKVKIEKNASKLQILKEVCKSMK

srp19

Signal recognition particle 19 kDa protein

89 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.462 kDa

MKEMIIWPAYIDIKRTKNEGRKVPKEFAVANPKLKDIADKIKKMGLEHSIEIKKSYPMEPWEICGYIKVKLDKNTSKLQILKEISKNMK

srp19

Signal recognition particle 19 kDa protein

89 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.461 kDa

MKEIILWPAYIDLKRTKNEGRKVPKEIAIQNPKLKEIASKIKKMGLEYSVENKKSYPKESWEICGYIKVKVDESTSKLQFLKEICINMK

srp19

Signal recognition particle 19 kDa protein

89 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.499 kDa

MITVWPQYLDKNLSLNEGRKVSKEIAVEEPKLQDIEKALKRLNLPYSTQKERSYPGKWYEKSGRILVESDKPKLELLKEISLKLQEIKQ

srp19

Signal recognition particle 19 kDa protein

89 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.537 kDa

MKEIVIWPAYFDLKRTKNEGRKVPKSFGVLNPKLKDIVSIIEKMGHEYSIDNKKSYPKEPWEICGYLKVTIDEKTSKLDFLKELCKRMK

srp19

Signal recognition particle 19 kDa protein

87 amino acids

Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Belongs to the SRP19 family.

10.352 kDa

MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRDKRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN