spo0A

Stage 0 sporulation protein A homolog

281 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

31.53 kDa

MESRKISVLIADDNKEFCNILNDYLLNQSDMIVVGIAKDGVEALKLIENKKPDLVVLDIIMPRLDGLGVLEKLNNKDAENLPRIIVLSAVGQDKITQRAITLGADYYVVKPFDMDVFTNRIREMFNNTISNSEQKRSYQVEEKEASFAGTIANDVYSDNIGNKAVDLESEITSIIHQIGVPAHIKGYMYLREAITMVVNNMELLSAVTKELYPSIAKKYNTTASRVERAIRHAIEVAWSRGQVETINKLFGYTINNGKGKPTNSEFIAMIADKLRLKNKVS

spo0A

Stage 0 sporulation protein A homolog

277 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

31.804 kDa

MNNKMNVYLVDDSMEMIHSMKEALTKSDGYQVIGSATNGEQCVNELRGKHLDVLVLDLIMPKKDGISVLHDLKKNHIQVDHIICTTPFVNDLIVAGVQNYRIDYILMKPFEIEQLCDKLNFIVGYTRKEHISSNVLQVNLDDDEKERLQKLELESEITELLHEIGIPAHIKGYMYLRTAILETYLNVDFLGQITKVLYPEIAKKYATTASRVERAIRHAIEVAWNRGNIDAIDDIFGYTISASKAKPTNSEFIAMISDKLRLEHRLRNKNNVIKTFR

spo0A

Stage 0 sporulation protein A homolog

274 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

30.868 kDa

MGGFLVEKIKIVLADDNKDFCQVLKEYLSNEDDIDILGIAKDGIEALDLVKKTQPDLLILDVIMPHLDGLGVIEKLNTMDIPKMPKIIVLSAVGQDKITQSAINLGADYYIVKPFDFVVFINRIRELVSNRVTQVEPKPRPVQETQMTRSDFVKNVGNIETEITNIIHEIGVPAHIKGYLYLREAMKMVIDNVELLGAVTKELYPSIAKKFNTTPSRVERAIRHAIEVAWSRGKVDTINQLFGYTVHNTKGKPTNSEFIAMIADKLRLEHSMVK

spo0A

Stage 0 sporulation protein A homolog

273 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

30.684 kDa

MEDSKISVLIADDNKEFCSILNDYLLNQKDIVVTGIAKDGREALELIVERKPDLVILDIIMPHLDGLGVLEKLNTMQLEKVPRIIILSAVGQDKITQQAITLGADYYTVKPFDMEVFTKRIREMFNSSAAVQETNMRNSYASSMISTPSENKTKAPIDLETEITNIIHEVGVPAHIKGYMYLREAITMVVNDMELLSAVTKELYPSIAKKYNTTASRVERAIRHAIEVAWGRGQIEAINRLFGYTVHNDKGKPTNSEFIAIIADKLRLKNKVS

spo0A

Stage 0 sporulation protein A homolog

273 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

30.601 kDa

MEYSKISVLIADDNKEFCNILNDYLLNQSDIVVVGIAKDGIEALKLIEEKKPDLVILDIIMPNMDGLVVLEKLANINIDPVPNVIVLSAVGQDKITQRAITLGADYYVVKPFDMDVFTKRIRQMFNNTILDSETKKTMPISEKAADVKISQSVPLDLEDESIIHEIGVPAHIKGYMYLREAINMVVDNIELLSAVTKELYPSIAKKYNTTASRVERAIRHAIEVAWSRGQVDTINKLFGYTIHNGKGKPTNSEFIAMIADKLRLKNKVKNVAQ

spo0A

Stage 0 sporulation protein A

267 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box).

29.691 kDa

MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLFKEKDPDVLVLDIIMPHLDGLAVLERLRESDLKKQPNVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLVGHIRQVSGNASSVTHRAPSSQSSIIRSSQPEPKKKNLDASITSIIHEIGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTVSMTKAKPTNSEFIAMVADKLRLEHKAS

spo0A

Stage 0 sporulation protein A

264 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

29.44 kDa

MEKIKVCLVDDNKELVSMLESYVAAQDDMEVIGTAYNGQECLNLLKDKQPDVLVLDIIMPHLDGLAVLEKMRHIERLRQPSVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLTSHIRQVSGKANATIKRPLPSFRSATTVDGKPKNLDASITSIIHEIGVPAHIKGYMYLREAISMVYNDIELLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTVSMSKAKPTNSEFIAMVADKLRLEHKAS

spo0A

Stage 0 sporulation protein A

264 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

29.415 kDa

MEKIKVCLVDDNKELVSMLESYVAAQDDMEVIGTAYNGQECLNLLTDKQPDVLVLDIIMPHLDGLAVLEKMRHIERLKQPSVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLTSHIRQVSGKANAMIKRPLPSFRSATTVDGKPKNLDASITSIIHEIGVPAHIKGYMYLREAISMVYNDIELLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTVSMSKAKPTNSEFIAMVADKLRLEHKAS

spo0A

Stage 0 sporulation protein A

264 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

29.415 kDa

MEKIKVCLVDDNKELVSMLESYVAAQDDMEVIGTAYNGQECLNLLTDKQPDVLVLDIIMPHLDGLAVLEKMRHIERLKQPSVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLTSHIRQVSGKANAMIKRPLPSFRSATTVDGKPKNLDASITSIIHEIGVPAHIKGYMYLREAISMVYNDIELLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTVSMSKAKPTNSEFIAMVADKLRLEHKAS

spo0A

Stage 0 sporulation protein A

263 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

29.806 kDa

MTKVKVAIADDNRELLKTMEHYFQGHPEIEIIATASNGKVCLQMLEEYTPDILLLDIIMPHLDGLAVLEAMYQNDRMSSIQVIMLTAFGQEDVMKQAVDLGASYFMLKPFEFDQLVQKILHCAGQKASIPKKASVLQPTTPQKLNQHQLDSTITAIIKEIGVPAHIKGYSYLREAIQMVFEDIELLGSVTKILYPEIAKKFNTTPSRVERAIRHAIEVAWNRGNYEYISSMFGYTEHHLKSKPTNSEFIAMIADKIRIDMMAS

spo0A

Stage 0 sporulation protein A

259 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

28.97 kDa

MSIKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGKTTPVVRKAAPAPQVRDNKPKNLDASITSIIHEIGVPAHIKGYLYLREAIAMVYHDIELLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNLESISSLFGYTVSVSKAKPTNSEFIAMVADKLRLEHKAS

spo0A

Stage 0 sporulation protein A homolog

256 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

28.988 kDa

MEAIKVLIADDNREFCEVLEEYFNEQEDFVLSGVAHNGQETLELIQEQEPDIVILDIIMPHLDGIGVLEKLQVLNFEPRPKIVILTALGQESMTMRSVELGADYYILKPFDLEVLGNRLRQLANGHPLPTAPSQVSRAGRNMDVEVTKIIHQMGVPAHIKGYQYLREAILMVIDDVSLLGAVTKELYPLIARKYMTTPSRVERAIRHAIELAWDRGNVEMMNKFFGYTINVERGKPTNSEFIAMVADKLRIGAKIN

spo0A

Stage 0 sporulation protein A

212 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

23.862 kDa

single

MKKIKVCLVDDNRELIGLLEDYISEQEDMEVIGVAYNGQECLSILKDKNPDVLVLDIIMPHLDGLAVLGQLKEMKKENYPNVIMLTAFGQEDVTKKAVDLGAAYFILKPFDMENLVNHIRQVSGQTSSFMQRSSSSMRSHRDSKPANLDASITSIIHEIGVPAHIKGYLYLREAISMVYKDIELLGSITKVLYPDIAKKYNTTASRVERAIR

spo0A

Stage 0 sporulation protein A

212 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

23.843 kDa

single

MSKIEVLLADDNREFVSLLEEYISSQYDMNVIGVAYNGNEVVRLLQERVPDVLILDIIMPHLDGLAVLEQIQAMRLSPQPKIIMLTAFGQEEITKKAVELGAAYYILKPFDMEVLAQRIRQIITTKPASSFVTSVKPQSTLQVRGRNLDASITSIIHEIGVPAHIKGYLYLREAITMVYNDVELLGSITKVLYPDIAKKFNTTASHVERAIR

spo0A

Stage 0 sporulation protein A

210 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

23.689 kDa

single

MKKIKVCIVDDNRELVGLLEEYIDAQDDMEVIGVAHNGQECLELVEQLEPDVMVLDIIMPHIDGLAVLERMRQMNKPMPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMEYLASHIRQVSGKTTGFVRKSSSSFKTQEPKTKNLDASITSIIHEIGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKYNTTASRVERAIR

spo0A

Stage 0 sporulation protein A

191 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

21.288 kDa

single

LAVLERLRENNEMTKQPSVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLVGHIRQVSGNGTQVTHRSSSIQNSVLRNKPPEPKRKNLDASITTIIHEIGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTVSMSKAKPTNSEFIA

spo0A

Stage 0 sporulation protein A homolog

161 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process (By similarity).

18.134 kDa

single

LGVLEKLNTMDLEKTPRIIILSAVGQDKITQQAITLGADYYTVKPFDMEVFTKRIREMFNSAPTIQESSAQSNRVSYPTTSSYILTSEPKSKTPVDLETEITNIIHEIGVPAHIKGYMYLREAITMVVNDMELLSAVTKELYPSIAKKYNTTASRVERAIR

spo0A

Stage 0 sporulation protein A

150 amino acids

May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with Spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process. Repressor of abrB, activator of the spoIIa operon. Binds the DNA sequence 5'-TGNCGAA-3' (0A box) (By similarity).

16.844 kDa

single

LAVLEKMRHIERLKQPSVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLPSHIRQVSGKANTMIKRPLPSFRSATTVDGKPKNLDASITSIIHEIGVPAHIKGYMYLREAISMVYNDIELLGSITKVLYPDIAKKYNTTASRVERAIR