SPC2

Signal peptidase complex subunit SPC2

178 amino acids

Nonessential component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum. SPC2 enhances the enzymatic activity of SPC and facilitates the interactions between different components of the translocation site.

Belongs to the SPCS2 family.

20.802 kDa

MSSAKPINVYSIPELNQALDEALPSVFARLNYERSYALLDAKLYIGYSIAVVAGLSFFLDKKFERDQIVTYQKLLVGAYFVLSLLFWYFSRFIEKGTVYVGKRRGTKEEIYVKTKFEKNEPLYLVELVQKKKGENSKKELKAKLEVNKVFNESGYLQNDAYFKWFSEQHNVLDTKKNE

spc2

Signal peptidase complex subunit spc2

167 amino acids

Nonessential component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum. Spc2 enhances the enzymatic activity of SPC and facilitates the interactions between different components of the translocation site (By similarity).

Belongs to the SPCS2 family.

19.051 kDa

MPKYNVSDFKSKFDKELTNHFNKNGYKQSFVFEDIRLLIAIACIIPAGLAFGIEYVYGFGVLKSYLKYLLPLYFLASCLLTFWSSVVKGSTVYVATKKERHIKISADTFLPLKNKPLITTKFTVLKNRNAVQLEWSVPVAHIFEEDGQISSATFEAEISKYLSQIEN