spaR

Surface presentation of antigens protein SpaR

263 amino acids

Involved in a secretory pathway responsible for the surface presentation of determinants needed for the entry of Salmonella species into mammalian cells.

Belongs to the FliR/MopE/SpaR family.

28.487 kDa

MFYALYFEIHHLVASAALGFARVAPIFFFLPFLNSGVLSGAPRNAIIILVALGVWPHALNEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDNQRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNECTPSLPPLLTFINQVAQNALVLASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGIAVLIMLLYFSPVLPDNVLRLSFQATGLSSWFYERGATHVLE

spaR

Surface presentation of antigens protein SpaR

256 amino acids

Required for surface presentation of invasion plasmid antigens. Could play a role in preserving the translocation competence of the ipa antigens. Required for invasion and for secretion of the three ipa proteins.

Belongs to the FliR/MopE/SpaR family.

28.498 kDa

MDISSWFESIHVFLILLNGVFFRLAPLFFFLPFLNNGIISPSIRIPVIFLVASGLITSGKVDIGSSVFEHVYFLMFKEIIVGLLLSFCLSLPFWIFHAVGSIIDNQRGATLSSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLSYNICPLFSQCSFRISNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSLLAIFIIFICSSTIYFSKVQFFLGEHKFFTNLFVR

spaR

Surface presentation of antigens protein SpaR

256 amino acids

Required for surface presentation of invasion plasmid antigens. Could play a role in preserving the translocation competence of the ipa antigens. Required for invasion and for secretion of the three ipa proteins (By similarity).

Belongs to the FliR/MopE/SpaR family.

28.484 kDa

MDISSWFESIHVFLILLNGVFFRLAPLFFFLPFLNNGIISPSIRIPVIFLVASGLITSGKVDIGSSVFEHVYFLMFKEIIVGLLLSFCLSLPFWIFHAVGSIIDNQRGATLSSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLSYNICPLFSQCSFRVSNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSLLAIFIIFICSSTIYFSKVQFFLGEHKFFTNLFVR

spaR

Transcriptional regulatory protein SpaR

220 amino acids

Member of the two-component regulatory system SpaK/SpaR involved in the regulation of the biosynthesis of lantibiotic subtilin. SpaR may function as a regulatory protein.

25.615 kDa

MAKILAVDDEKDILVLIQNILRRDQHQVDILDHVHGQPPDVFQGYDLILLDVMMPDIDGFELCKQIRPLVDCPILFLTAKTEEEAIVKGLITGGDDYITKPFGVRELSARVNAHLRRERRDKHQSKRVISGFLFHFDSKEVFINNNKLNLTKNEYKICEFLAQHKGRTFSREQIYEEIYGLEGNALYSTITEFIRTIRKKCKEHNADPIKTVWGVGYKWE