sopB

Inositol phosphate phosphatase SopB

561 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cells.

Belongs to the phosphatase IpgD/SopB family.

61.854 kDa

MQIQSFYHSASLKTQEAFKSLQKTLYNGMQILSGQGKAPAKAPDARPEIIVLREPGATWGNYLQHQKTSNHSLHNLYNLRRDLLTVGATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQDKQLNNQPWQTIKNTLTHNGHHYTNTQLPAAEMKIGAKDIFPSAYEGKGVCSWDTKNIHHANNLWMSTVSVHEDGKDKTLFCGIRHGVLSPYHEKDPLLRQVGAENKAKEVLTAALFSKPELLNKALAGEAVSLKLVSVGLLTASNIFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGDLQTVKIKPDVAAFNVGVNELALKLGFGLKASDSYNAEALYQLLGNDLRPEARPGGWVGEWLAQYPDNYEVVNTLARQIKDIWKNNQHHKDGGEPYKLAQRLAMLAHEIDAVPAWNCKSGKDRTGMMDSEIKREIISLHQTHMLSAPGSLPDSGGQKIFQKVLLNSGNPGDSEPNTGGAGNKVMKNLSPEVLNLSYQKRVGDENIWQSVKGISSLITS

sopB

Inositol phosphate phosphatase SopB

561 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cell (By similarity).

Belongs to the phosphatase IpgD/SopB family.

62.017 kDa

MQIQSFYHSASLKTQEAFKSLQKTLYNGMQILSGQGKAPAKAPDARPEIIVLREPGATWGNYLQHQKTSNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQNGLPAKEAHRFAAVAFRDAQVKQLNNQPWQTIKNTLTHNGHHYTNTQLPAAEMKIGAKDIFPSAYEGKGVCSWDTKNIHHANNLWMSTVSVHEDGKDKTLFCGIRHGVLSPYHEKDPLLRQAGAENKAKEVLAAALFSKPELLNRALEGEAVSLKLVSVGLLTASNIFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGDLQTVKIKPDVAAFNVGVNELALKLGFGLKASDSYNAEALHQLLGNDLRPEARPGGWVGEWLAQYPDNYEVVNTLARQIKDIWKNNQHHKDGGEPYKLAQRLAMLAHEIDAVPAWNCKSGKDRTGMMDSEIKRELISFHQTHMLSAPGSLPDSGGQKIFQKVLLNSGNLEIQKQNTGGAGNKVMKNLSPEVLNLSYQKRVGDENIWQSVKGISSLITS

sopB

Inositol phosphate phosphatase SopB

561 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cell.

Belongs to the phosphatase IpgD/SopB family.

61.935 kDa

MQIQSFYHSASLKTQEAFKSLQKTLYNGMQILSGQGKAPAKAPDARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPWQTIKNTLTHNGHHYTNTQLPAAEMKIGAKDIFPSAYEGKGVCSWDTKNIHHANNLWMSTVSVHEDGKDKTLFCGIRHGVLSPYHEKDPLLRHVGAENKAKEVLTAALFSKPELLNKALAGEAVSLKLVSVGLLTASNIFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGDLQTVKIKPDVAAFNVGVNELALKLGFGLKASDSYNAEALHQLLGNDLRPEARPGGWVGEWLAQYPDNYEVVNTLARQIKDIWKNNQHHKDGGEPYKLAQRLAMLAHEIDAVPAWNCKSGKDRTGMMDSEIKREIISLHQTHMLSAPGSLPDSGGQKIFQKVLLNSGNLEIQKQNTGGAGNKVMKNLSPEVLNLSYQKRVGDENIWQSVKGISSLITS

sopB

Inositol phosphate phosphatase SopB

433 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cell (By similarity).

Belongs to the phosphatase IpgD/SopB family.

47.75 kDa

single

VLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPWQTIKNTLTHNGHHYTNTQLPAAEMKIGAKDIFPSAYEGKGVCSWDTKNIHHANNLWMSTVSVHEDGKDKTLFCGIRHGVLSPYHEKDPLLRQVGAENKAKEVLTAALFSKPELLNKALAGEAVSLKLVSVGLLTASNIFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGDLQTVKIKPDVAAFNVGVNELALKLGFGLKASDSYNAEALHQLLGNDLRPEARPGGWVGEWLAQYPDNYEVVNTLARQIKDIWKNNQHHKDGGEPYKLAQRLAMLAHEIDAVPAWNCKSGKDRTGMMDSEIKREHISLHQTHMLSAPGSLPDSGGQKIFQKVLLNSGNLEIQKQNTGGAGNKVMKN

sopB

Inositol phosphate phosphatase SopB

416 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cell (By similarity).

Belongs to the phosphatase IpgD/SopB family.

45.795 kDa

single

PAQEAHQVAVAAFREAQVQYLNNQPWQTIKNTLTHNGYRYTNTQCPAADMKIGAQDIFPNAYQGKGVCSSDTTNTQHATNLWMSTLSVNENGKDKTLFCGIRHGVLSPYHVKDPILRQVGAENRAREVLTAALFSQPALLTKALQDEVVSLRLVSVGLLTTSTIVGNEDAMVQDQMRAWQSLTQPGNVIHLNIRNKEGELRTVKIKPEIAAFNTGVNELTLKLGLGHQASDNYNIGALHQLLGHDLRPEAPPGGWVGEWLAQHPDNHAVVNTLVRQIKDIWNSKLHHTDGNEPYKFAQRLAILAHEIGAVPAWNCKSGKDRTGMQDAEIKREVISLHQKATLTPLASLPDSDGQEIFQKVLLNSGNLEIQKQNTGGAGNKVLKNLPPEVLNLSYQRRIGDANIWQLVKGLSSLVTS

sopB

Inositol phosphate phosphatase SopB

416 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cell (By similarity).

Belongs to the phosphatase IpgD/SopB family.

46.118 kDa

single

PAKEAYRLAAATFRDAQVKHLNSQPWQTIKNTLTHNGHQYTNMQLPAADMKIGTQDIFPSAYQGKGVCSWDTKNIHHANNLWMSTVSAHEDGKDKTLFCGIRHGVLSPYDVKDPLLRQTGAENEAKEVLTAALFSKPELLTRALEGEAVNLKLVSVGLLTASNVFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGELQTVKIKPEIAAFNVGVNELALKLGFGLKTSDSYNVEALHQLLGNDLRPEAKPGGWVGDWLAQYPDNYEVVNILARQIKDIWKNNLHHKDGGEPYKLAQRLAMLANEIDAVPAWNCKSGKDRTGMMDSEIKREIICLHQTHTLNAPGSLPDRSGQEIFQKVLLNSGNLEIQKQNTGGAGNKVMKNLSPEVLNLSYQKRVGDENIWQSVKGISSLITS

sopB

Inositol phosphate phosphatase SopB

416 amino acids

Converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns 3-P and prevents the transition of PtdIns 3-P to PtdIns 3,5-P2. It is one of the known effectors injected by Salmonella into the host cell and is required for invasion and for an efficient generation and maintenance of Salmonella-containing vacuole (SVC). Alteration of the phosphoinositide composition of the plasma membrane causes membrane ruffling and actin cytoskeleton rearrangements. The persistence of PtdIns 3-P diverts the SCV from the endocytic pathway resulting in enlarged vesicles, which are essential to create a favorable environment where Salmonella can replicate and avoid immune defenses of the host cell (By similarity).

Belongs to the phosphatase IpgD/SopB family.

46.097 kDa

single

PAKEARRLAAADFKSAQVKQLNNQPWQTIKNTLTHNGHQYTSTQVPAAEMKIGAQDIFPKAYQGKGVCSWDTQNIHHATNLWMSTISVHEDGEDKTLFSGIRHGVLSPYHVEDPLLRQTGAESRAKEVLTAALFSKPELLTRALKGEAVSLKLVSVCLLTASNVLGQEGTMVKEQMRAWQSLTQPGKMIHLKIRNDDGELQTVKIKPEVAAFNVGVNELALKFGFGLKASDSYNIEALQQLLGNDLRPEARPGGWVGEWLARYPDNDESVNTLARQIKDIWQNKLHHKDGGEPYKLAQRLAMLANEIDVVPAWNCKSGKDRTGMMDSETKREAISFHQTHTLSSPGSLPDRSGQQIFQKVLLNSGNLEIQKQNTSGAGNKVIKNLSPEVLNLSYHKRIGDENTWQSVKGISTLIIS

sopB

Protein SopB

323 amino acids

Control of plasmid partitioning; required to recognize the cis-acting. Binds specifically with the DNA segment containing the sopC region. SopB is trans-acting (By similarity).

Belongs to the ParB family.

35.372 kDa

MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNAITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTPAFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQFAPGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP

sopB

Protein SopB

323 amino acids

Control of plasmid partitioning; required to recognize the cis-acting. Binds specifically with the DNA segment containing the sopC region. SopB is trans-acting.

Belongs to the ParB family.

35.372 kDa

MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNAITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTPAFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQFAPGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP