soc

Small outer capsid protein

80 amino acids

Capsid decoration protein which helps to stabilize the capsid against extremes of pH and temperature. Once maturation and expansion of the capsid has occured, trimers of soc attach the interfaces between the hexamer of the major capsid protein. Acts as a glue between neighboring hexameric capsomers. Dispensable for the head morphogenesis and phage infection.

Belongs to the Tevenvirinae Soc family.

9.117 kDa

MASTRGYVNIKTFEQKLDGNKKIEGKEISVAFPLYSDVHKISGAHYQTFPSEKAAYSTVYEENQRTEWIAANEDLWKVTG