smtB

Succinyl-CoA--L-malate CoA-transferase beta subunit

405 amino acids

Involved in the 3-hydroxypropionate cycle used for autotrophic carbon dioxide fixation. Catalyzes the transfer of CoA moiety from succinyl-CoA to L-malate to yield L-malyl-CoA (By similarity).

Belongs to the CoA-transferase III family.

44.384 kDa

MDGTTTTLPLAGIRVIDAATVIAAPFCATLLGEFGADVLKVEHPIGGDALRRFGTPTARGDTLTWLSESRNKRSVTLNLQHPEGARVFKELIAHSDVLCENFRPGTLEKWGLGWDVLSKINPRLIMLRVTGYGQTGPYRDRPGFARIAHAVGGIAYLAGMPKGTPVTPGSTTLADYMTGLYGCIGVLLALRHREQTGRGQYIDAALYESVFRCSDELVPAYGMYRKVRERHGSHYNEFACPHGHFQTKDGKWVAISCATDKLFARLANAMGRPELASSSVYGDQKVRLAHASDVNEIVRDWCSSLTRAEVLERCYATATPAAPLNDIADFFGDRHVHARRNLVAIDAEDLGETLIMPNVVPKLSETPGSIRSLGPKLGEHTEEVLKEILGMCDEQINDLRSKRVI

smtB

Succinyl-CoA--L-malate CoA-transferase beta subunit

405 amino acids

Involved in the 3-hydroxypropionate cycle used for autotrophic carbon dioxide fixation. Catalyzes the transfer of CoA moiety from succinyl-CoA to L-malate to yield L-malyl-CoA. It is highly specific for succinyl-CoA as the CoA donor, however it can accept L-citramalate instead of L-malate as the CoA acceptor.

Belongs to the CoA-transferase III family.

44.384 kDa

MDGTTTTLPLAGIRVIDAATVIAAPFCATLLGEFGADVLKVEHPIGGDALRRFGTPTARGDTLTWLSESRNKRSVTLNLQHPEGARVFKELIAHSDVLCENFRPGTLEKWGLGWDVLSKINPRLIMLRVTGYGQTGPYRDRPGFARIAHAVGGIAYLAGMPKGTPVTPGSTTLADYMTGLYGCIGVLLALRHREQTGRGQYIDAALYESVFRCSDELVPAYGMYRKVRERHGSHYNEFACPHGHFQTKDGKWVAISCATDKLFARLANAMGRPELASSSVYGDQKVRLAHASDVNEIVRDWCSSLTRAEVLERCYATATPAAPLNDIADFFGDRHVHARRNLVAIDAEDLGETLIMPNVVPKLSETPGSIRSLGPKLGEHTEEVLKEILGMCDEQINDLRSKRVI

smtB

HTH-type transcriptional repressor SmtB

135 amino acids

Transcriptional regulator involved in zinc homeostasis. Represses the expression of the smtB-zur operon in the absence of zinc. Could act as the metal sensor that controls the expression of zur in response to zinc availability (By similarity).

14.421 kDa

MVTSPSTPTAAHEDVGADEVGGHQHPADRFAECPTFPAPPPREILDAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALHVPQPLVSQHLKILKAAGVVTGERSGREVLYRLADHHLAHIVLDAVAHAGEDAI

smtB

HTH-type transcriptional repressor SmtB

135 amino acids

Transcriptional regulator involved in zinc homeostasis. Represses the expression of the smtB-zur operon in the absence of zinc. Could act as the metal sensor that controls the expression of zur in response to zinc availability.

14.421 kDa

MVTSPSTPTAAHEDVGADEVGGHQHPADRFAECPTFPAPPPREILDAAGELLRALAAPVRIAIVLQLRESQRCVHELVDALHVPQPLVSQHLKILKAAGVVTGERSGREVLYRLADHHLAHIVLDAVAHAGEDAI

smtB

Transcriptional repressor SmtB

122 amino acids

Transcriptional repressor of the expression of the smtA gene. Binds two zinc ions per dimer. The complex of DNA and SmtB is dissociated by zinc ions.

13.544 kDa

MTKPVLQDGETVVCQGTHAAIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQECR