SLC38A9

Sodium-coupled neutral amino acid transporter 9

561 amino acids

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed:25561175, PubMed:25567906, PubMed:29053970). Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids (PubMed:25561175, PubMed:25567906). Acts as an arginine sensor (PubMed:25567906, PubMed:29053970). Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation (PubMed:29053970).

Belongs to the amino acid/polyamine transporter 2 family. SLC38A9 subfamily.

63.776 kDa

MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM

Slc38a9

Sodium-coupled neutral amino acid transporter 9

560 amino acids

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids. Acts as an arginine sensor. Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation.

Belongs to the amino acid/polyamine transporter 2 family. SLC38A9 subfamily.

63.392 kDa

MASVDGDSRHLLSEVEHEVSPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQRVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVVKSRSTISTSDTSTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTVLSTNNSNPVICPNAGSGGRPDNSSMIFYNNNTEVQLFEKWWDKSRTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFVVTLKAVRLGFHLEFHWFVPTEFFVPEIRAQFPQLMGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYLYIGILVFASFPSPPLPKDCIEQNFLDNFPSSDILSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLVIVGAGVTMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLVFHVIIIILGLANLIAQFFM

Slc38a9

Sodium-coupled neutral amino acid transporter 9

559 amino acids

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids. Acts as an arginine sensor. Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation.

Belongs to the amino acid/polyamine transporter 2 family. SLC38A9 subfamily.

63.418 kDa

MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVVKSRSMIVTSDTTTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTVLSTNNSSPVICPSAGSGHPDNSSMIFYNSDTEVRLFERWWDKSKTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFIVTLKAIRLGFHLEFHWFAPTEFFVPEIRAQFPQLTGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLPKDCIEQNFLDNFPSSDTLSFIARICLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVTMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYILSQHQEERLTWPKLVFHIIIIILGLANLIAQFFM

slc38a9

Sodium-coupled neutral amino acid transporter 9

554 amino acids

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids. Acts as an arginine sensor. Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation.

Belongs to the amino acid/polyamine transporter 2 family. SLC38A9 subfamily.

62.141 kDa

MDSDQTPLINPSLFEECAQNHFAAADSRSRRPFHIEPSYITSINDDEPQRITSEASAMNKRIHYYSKLSYPSGGGLIAPDHVLPAPEEIYVYSPLGTALKIDGSDGSEKNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCVLFLMGILTLYCCYRVVKSRGTIPLTDTSTWEFPDVCQYYFGSFGRWSSLLFSMVSLIGAMIVYWVLMSNFLFNTGKFIYNYVNDVNITDDVLSNNGTDKVICPNPDSTGPLNKSMDTYYGNGTNLEHFETWWSKTNTVPFYLVVLLLPLLGFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLQFSWNQVQTFFVPEFRVSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYVYVGVVVFASFPSPPLSKQCIEQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYPSIFHVLALNIAVVGVGVIMARFYPNIGGIIRFSGAACGLAFVFVYPSLIHMISLHRRGQLRIHSILIHVSIIVLGISNLIAQFFM

slc38a9

Sodium-coupled neutral amino acid transporter 9

554 amino acids

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids. Acts as an arginine sensor. Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation.

Belongs to the amino acid/polyamine transporter 2 family. SLC38A9 subfamily.

62.278 kDa

MDSDQTPLINPSLFEECAQNHFAATDPRSRRPFHIEPSYITSINDDDPQRITSVASAMNKRIHYYSKLSNPSDKGLIAPDHVLPAPEEIYVYSPLGTALKIDGSDGTGKNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVNDVNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYFGNGTNYEQFETWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYPSVFHVLALNIAVVGVGVIMARFYPNIGGIIRFSGAACGLAFVFVYPSLIHMISLHRRGQLKVHSILIHVSIIVLGIANLIAQFFM

slc38a9

Sodium-coupled neutral amino acid transporter 9

549 amino acids

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acid levels. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids. Acts as an arginine sensor. Following activation by arginine binding, mediates transport of leucine, tyrosine and phenylalanine with high efficiency, and is required for the efficient utilization of these amino acids after lysosomal protein degradation.

Belongs to the amino acid/polyamine transporter 2 family. SLC38A9 subfamily.

61.897 kDa

MDEDSKPLLGSVPTGDYYTDSLDPKQRRPFHVEPRNIVGEDVQERVSAEAAVLSSRVHYYSRLTGSSDRLLAPPDHVIPSHEDIYIYSPLGTAFKVQGGDSPIKNPSIVTIFAIWNTMMGTSILSIPWGIKQAGFTLGIIIIVLMGLLTLYCCYRVLKSTKSIPYVDTSDWEFPDVCKYYFGGFGKWSSLVFSLVSLIGAMVVYWVLMSNFLFNTGKFIFNYVHNVNTSDAFGTNGTERVICPYPDVDPHGNSSTSLYSGSDNSTGLEFDHWWSKTNTIPFYLILLLLPLLNFRSASFFARFTFLGTISVIYLIFLVTYKAIQLGFHLEFHWFDSSMFFVPEFRTLFPQLSGVLTLAFFIHNCIITLMKNNKHQENNVRDLSLAYLLVGLTYLYVGVLIFAAFPSPPLSKECIEPNFLDNFPSSDILVFVARTFLLFQMTTVYPLLGYLVRVQLMGQIFGNHYPGFLHVFVLNVFVVGAGVLMARFYPNIGSIIRYSGALCGLALVFVLPSLIHMVSLKRRGELRWTSTLFHGFLILLGVANLLGQFFM