sigK

SrfA-induced gene K protein

426 amino acids

46.615 kDa

MKKMKILSFFILSLAIIIGIVYSRQCDDKCKQDYPYSSCNGNLNLYRGLGYDGNGNVIFSGKYNSSQGSGGFGLPSIFSVPSSGGCQLSKRFDIQGEILDGPGYTALDYFYKYLPQLDRYYVRFNQRGSPIFSIYNQTSNEIKAVFNIFNTPFVPAFSQNESAPFFVYGGYGIYGLAKYPTDRSDAQQAKLIYQSQIVNGLEIDGDQLYMTTYQGQFLKGSLNCLNCTKDQLQLLVTDSELASATSVSGFALTSDYMYFSYSGGIKGYPKNGDASRVRKLVSENVVAMISNGDFLYYQTDSGVVKSVSTSGNHPQVNILYTPVSDNQCQCSVGFSGDDCRQCDNGMVLWASDNGIPMCSPLNSLGKPKTCYAAYQCGSSPFIICNGTCTCLPGFSGNDCTLCGNGGEVIWENGYPTCVIQIKKIIT

sigK

RNA polymerase sigma-K factor

294 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is responsible for the expression of sporulation specific genes in the mother cell.

Belongs to the sigma-70 factor family.

33.606 kDa

MVTGVFAALGFVVKELVFLVSYVKNNAFPQPLSSSEEKKYLELMAKGDEHARNMLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKLATYAARCIENEIVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKSMPPLFVMNNEILMHLRALKKTKKDVSLHDPIGQDKEGNEISLIDVLKSENEDVIDTIQLNMELEKVKQYIDILDDREKEVIVGRFGLDLKKEKTQREIAKELGISRSYVSRIEKRALMKMFHEFYRAEKEKRKKAKGK

sigK

RNA polymerase sigma-28 factor

237 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor directs the transcription of crystal protein genes, a sporulation-regulated event (By similarity).

Belongs to the sigma-70 factor family.

27.136 kDa

MSLFAAIGYMVREVFVFVSYVKNNAFPQPLSSDDERKYLELMEQGDAQARNLLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEILMHLRVLKKTKKDVSLHDPIGQDKEGNEISLIDILKSESEDVIDMIQLSMELEKIKEYIDILDEREKEVIVKRFGLGLDKEKTQREIAKALGISRSYVSRIEKRALMKMFHEFVRAEKEKKAKE

sigK

RNA polymerase sigma-28 factor

237 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor directs the transcription of crystal protein genes, a sporulation-regulated event (By similarity).

Belongs to the sigma-70 factor family.

27.136 kDa

MSLFAAIGYMVREVFVFVSYVKNNAFPQPLSSDDERKYLELMEQGDAQARNLLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEILMHLRVLKKTKKDVSLHDPIGQDKEGNEISLIDILKSESEDVIDMIQLSMELEKIKEYIDILDEREKEVIVKRFGLGLDKEKTQREIAKALGISRSYVSRIEKRALMKMFHEFVRAEKEKKAKE

sigK

RNA polymerase sigma-28 factor

237 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor directs the transcription of crystal protein genes, a sporulation-regulated event.

Belongs to the sigma-70 factor family.

27.136 kDa

MSLFAAIGYMVREVFVFVSYVKNNAFPQPLSSDDERKYLELMEQGDAQARNLLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEILMHLRVLKKTKKDVSLHDPIGQDKEGNEISLIDILKSESEDVIDMIQLSMELEKIKEYIDILDEREKEVIVKRFGLGLDKEKTQREIAKALGISRSYVSRIEKRALMKMFHEFVRAEKEKKAKE

sigK

ECF RNA polymerase sigma factor SigK

196 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.632 kDa

MTASVLVGAAARLPLVTAELDALLRQVAQRDAEAFAAFYDQTRARVYGLITRVLRDPGYSEETTQDVYLQVWRNAAGYDPSVGSALSWLLTLAHRRAVDRVRSEQAASTRESRYGAISVDPPSDHVADDVLLDDERRRVAGCLDSLTDVQRECIQLAYYDGLTYAQVADRLAANLATIKSRMRDGIRALRKCLGVA

sigK

ECF RNA polymerase sigma factor SigK

193 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.716 kDa

MTALTQPVRLPFVTTDLDVLLRQVAERDVDAFAALYDRTRSRVYGMVTRVLRDPGYSEETTQDIYLQVWRSAGSYDPKAGSPMAWLLTLAHRRAVDRVRSEEAASQRESRYGAASVDPPVDHVADSVILLDERRRVVDCMGSLSDLQREAIQLAYYEGLTYVQVSERLSANLATIKSRMRDGIRGLKNCLGMS

sigK

ECF RNA polymerase sigma factor SigK

193 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.658 kDa

MTALTQPVRLPFVTTDLDVLLRQVAERDVDAFAALYDRTRSRVYGMVTRVLRDPGYSEETTQDIYLQVWRSAGSYDPKAGSPMAWLLTLAHRRAVDRVRSEEAASQRESRYGAASVDPPVDHVADSVILLDERRRVVDCMGSLSDLQREAIQLAYYEGLTYVQVSERLSANLATIKSRMRGGIRGLKNCLGMS

sigK

RNA polymerase sigma factor SigK

193 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

Belongs to the sigma-70 factor family. ECF subfamily.

21.658 kDa

MTALTQPVRLPFVTTDLDVLLRQVAERDVDAFAALYDRTRSRVYGMVTRVLRDPGYSEETTQDIYLQVWRSAGSYDPKAGSPMAWLLTLAHRRAVDRVRSEEAASQRESRYGAASVDPPVDHVADSVILLDERRRVVDCMGSLSDLQREAIQLAYYEGLTYVQVSERLSANLATIKSRMRGGIRGLKNCLGMS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.035 kDa

MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis. Sigma-K controls genes such as mpb70 and mpb83. However, in strains with the start codon mutation (AUA), there is a decrease in SigK expression, thus affecting SigK-regulated genes expression as well.

Belongs to the sigma-70 factor family. ECF subfamily.

21.035 kDa

MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.035 kDa

MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.035 kDa

MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

21.035 kDa

MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis. Sigma-K controls genes such as mpt70 and mpt83.

Belongs to the sigma-70 factor family. ECF subfamily.

21.035 kDa

MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS

sigK

ECF RNA polymerase sigma factor SigK

187 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

20.832 kDa

MTGPPGRSDDLNALLRQIARGERDAFAMFYDHTCTRVYGLVARVLRDAGYSEETTQEIYLEVWRTASDYDATKGSPLAWLLTMAHRRAVDRVRAEQAGSQRESRYGAANVDLASDVVADSAIAGDERRRVVECLDGLTDTQRQCIELAYYGGLTYAEVSQRLATNLSTIKSRMRDALRGLRNCLDAS