sigI

Probable ECF RNA polymerase sigma factor SigI

290 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor until released, although no anti-sigma factor is known for this protein (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

31.431 kDa

MSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGDIDDERGWLIVVTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPADRVTLDDEVRLALLIMLERLGPAERVVFVLHEIFGLPYQQIATTIGSQASTCRQLAHRARRKINESRIAASVEPAQHRVVTRAFIEACSNGDLDTLLEVLDPGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQPVCGQPAVLAFVNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG

sigI

Probable ECF RNA polymerase sigma factor SigI

290 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor until released, although no anti-sigma factor is known for this protein (By similarity).

Belongs to the sigma-70 factor family. ECF subfamily.

31.431 kDa

MSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGDIDDERGWLIVVTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPADRVTLDDEVRLALLIMLERLGPAERVVFVLHEIFGLPYQQIATTIGSQASTCRQLAHRARRKINESRIAASVEPAQHRVVTRAFIEACSNGDLDTLLEVLDPGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQPVCGQPAVLAFVNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG

sigI

RNA polymerase sigma factor SigI

251 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is involved in regulation of cell wall metabolism in response to heat stress. Acts by regulating the expression of genes such as bcrC, mreBH and lytE (PubMed:18156261, PubMed:21541672, PubMed:23199363). Also plays a role in survival at low temperatures (PubMed:19114499).

Belongs to the sigma-70 factor family. SigI subfamily.

29.193 kDa

MKPVLSLLFKLGKKKQTLEKAVESIQKGNKDLQNELIQQYKPFIAKTVSSVCKRYIDEKDDEFSIGLIAFNEAIEKYSPEKGNSLLAFAELIIKRKVIDYIRKEARSAQNINIDLQEGDDQESSQSLIEAELSIDEYRRQIEQEQRREEILYFQKQLKDYGLSFKELLENSPKHTDARQNAIKVAMTLVEHEELAAILYTKKQLPVKQLEQLVSVSRKTIERNRKYIIAMCIIITGDYIYLKDYLKGVLHS

sigI

RNA polymerase sigma factor SigI

240 amino acids

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor contributes to both stress response and virulence gene expression.

Belongs to the sigma-70 factor family. SigI subfamily.

28.822 kDa

MLSLVMKILRKPKIEDIVCNIQNNEEDKEAFIVQYQPFIRKSISSVCRRYITEQDDEYSIGLFAFNEAIEQYSYKKGKSFLAFADLLIKRDVIDYIRKESKHNLVFLKEDEQEEMLEMQVSLTEYMKEIENGNRKEEILHFQSVLADFKITFSELAKESPKHRDTREHLIEIVKVIIKEEEMMEELFRKKKLPLKHIEPRVRVSRKTLERHRKYIIAMCIIFANNYTYILDYIRGGKHDE